SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41350198|ref|NP_060174.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41350198|ref|NP_060174.2|
Domain Number 1 Region: 72-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.39e-39
Family Ankyrin repeat 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41350198|ref|NP_060174.2|
Sequence length 239
Comment ankyrin repeat domain-containing protein 49 [Homo sapiens]
Sequence
MEKEKGNDDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNE
EWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGH
LDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHL
AAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS
Download sequence
Identical sequences A0A024R398 G3QYS9 Q8WVL7
9606.ENSP00000303518 NP_060174.2.87134 NP_060174.2.92137 XP_003813842.1.60992 XP_004052031.1.27298 XP_008964660.1.60992 XP_016873430.1.92137 XP_018892974.1.27298 ENSP00000303518 ENSP00000440396 ENSGGOP00000008021 ENSGGOP00000008021 ENSP00000303518 ENSP00000303518 ENSP00000440396 GO.41769 gi|41350198|ref|NP_060174.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]