SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41406082|ref|NP_958799.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41406082|ref|NP_958799.1|
Domain Number 1 Region: 14-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.85e-26
Family Glutathione peroxidase-like 0.000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41406082|ref|NP_958799.1|
Sequence length 98
Comment glutathione peroxidase 1 isoform 2 [Homo sapiens]
Sequence
MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMN
ELQRRLGPRGLVVLGFPCNQFGHQVRRAERGGAGADVQ
Download sequence
Identical sequences ENSP00000391316 ENSP00000391316 gi|41406082|ref|NP_958799.1| NP_958799.1.87134 NP_958799.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]