SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41872522|ref|NP_963290.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41872522|ref|NP_963290.1|
Domain Number 1 Region: 309-639
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.19e-54
Family Diacylglycerol kinase-like 0.0085
Further Details:      
 
Domain Number 2 Region: 811-927
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.75e-20
Family Ankyrin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|41872522|ref|NP_963290.1|
Domain Number - Region: 107-163
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00963
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41872522|ref|NP_963290.1|
Sequence length 945
Comment diacylglycerol kinase zeta isoform 1 [Homo sapiens]
Sequence
MAEGQGGGGQRWDWAGGGRAAEEEVVRRRCRRGEEAQVAQPWPEGSRGTAAGPPVEERFR
QLHLRKQVSYRKAITKSGLQHLAPPPPTPGAPCSESERQIRSTVDWSESATYGEHIWFET
NVSGDFCYVGEQYCVARMLKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRN
VREPTFVRHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFML
QQIEEPCSLGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPF
IIRPTPSPLMKPLLVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKV
HNLRILACGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSK
ILSHVEEGNVVQLDRWDLHAEPNPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEF
HESREANPEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQ
CVVFLNIPRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQ
CREVVLTTSKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQ
LRIQVSRVSMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGA
KSPTCQKLSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDL
PTPTSPLPTSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQS
RTLLHHAVSTGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGAS
LMKTDQQGDTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV
Download sequence
Identical sequences ENSP00000343065 ENSP00000343065 NP_963290.1.87134 NP_963290.1.92137 gi|41872522|ref|NP_963290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]