SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|41872557|ref|NP_957716.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|41872557|ref|NP_957716.1|
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.91e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000641
Further Details:      
 
Domain Number 2 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-34
Family Spermadhesin, CUB domain 0.0000199
Further Details:      
 
Domain Number 3 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.64e-34
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 4 Region: 433-545
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.76e-27
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|41872557|ref|NP_957716.1|
Sequence length 555
Comment neuropilin-2 isoform 6 precursor [Homo sapiens]
Sequence
MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSML
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQPKVGCSWRPL
Download sequence
Identical sequences NP_957716.1.87134 NP_957716.1.92137 gi|41872557|ref|NP_957716.1| ENSP00000387519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]