SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|42544159|ref|NP_006635.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|42544159|ref|NP_006635.2|
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.89e-56
Family Actin/HSP70 0.0000327
Further Details:      
 
Domain Number 2 Region: 195-383
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.71e-51
Family Actin/HSP70 0.0000352
Further Details:      
 
Domain Number 3 Region: 386-495,587-639
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 7.85e-25
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.011
Further Details:      
 
Domain Number 4 Region: 633-715
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 8.24e-16
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0068
Further Details:      
 
Domain Number 5 Region: 718-811
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000000000000147
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|42544159|ref|NP_006635.2|
Sequence length 858
Comment heat shock protein 105 kDa [Homo sapiens]
Sequence
MSVVGLDVGSQSCYIAVARAGGIETIANEFSDRCTPSVISFGSKNRTIGVAAKNQQITHA
NNTVSNFKRFHGRAFNDPFIQKEKENLSYDLVPLKNGGVGIKVMYMGEEHLFSVEQITAM
LLTKLKETAENSLKKPVTDCVISVPSFFTDAERRSVLDAAQIVGLNCLRLMNDMTAVALN
YGIYKQDLPSLDEKPRIVVFVDMGHSAFQVSACAFNKGKLKVLGTAFDPFLGGKNFDEKL
VEHFCAEFKTKYKLDAKSKIRALLRLYQECEKLKKLMSSNSTDLPLNIECFMNDKDVSGK
MNRSQFEELCAELLQKIEVPLYSLLEQTHLKVEDVSAVEIVGGATRIPAVKERIAKFFGK
DISTTLNADEAVARGCALQCAILSPAFKVREFSVTDAVPFPISLIWNHDSEDTEGVHEVF
SRNHAAPFSKVLTFLRRGPFELEAFYSDPQGVPYPEAKIGRFVVQNVSAQKDGEKSRVKV
KVRVNTHGIFTISTASMVEKVPTEENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGT
QPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEA
NLVWQLGKDLLNMYIETEGKMIMQDKLEKERNDAKNAVEEYVYEFRDKLCGPYEKFICEQ
DHQNFLRLLTETEDWLYEEGEDQAKQAYVDKLEELMKIGTPVKVRFQEAEERPKMFEELG
QRLQHYAKIAADFRNKDEKYNHIDESEMKKVEKSVNEVMEWMNNVMNAQAKKSLDQDPVV
RAQEIKTKIKELNNTCEPVVTQPKPKIESPKLERTPNGPNIDKKEEDLEDKNNFGAEPPH
QNGECYPNEKNSVNMDLD
Download sequence
Identical sequences A0A024RDS1 A0A2J8UTF1 G3S272 H2Q7D9 Q92598
HR3530 ENSPTRP00000009802 NP_006635.2.87134 NP_006635.2.92137 XP_003314151.1.37143 XP_004054387.1.27298 XP_008950456.1.60992 ENSP00000318687 gi|42544159|ref|NP_006635.2| 9598.ENSPTRP00000009802 9600.ENSPPYP00000005987 9606.ENSP00000318687 ENSPTRP00000009802 ENSP00000318687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]