SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4501883|ref|NP_001604.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4501883|ref|NP_001604.1|
Domain Number 1 Region: 149-377
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.19e-99
Family Actin/HSP70 0.000000001
Further Details:      
 
Domain Number 2 Region: 6-155
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.51e-66
Family Actin/HSP70 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4501883|ref|NP_001604.1|
Sequence length 377
Comment actin, aortic smooth muscle [Homo sapiens]
Sequence
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
Download sequence
Identical sequences A0A087QZ18 A0A087VIS5 A0A091EC74 A0A091FP98 A0A091HQZ0 A0A091J5X4 A0A091JC92 A0A091LPG5 A0A091M1P1 A0A091MW47 A0A091QSB5 A0A091R5E9 A0A091S1J5 A0A091UEI7 A0A091ULM3 A0A091W7U7 A0A093CQU9 A0A093CV12 A0A093EZG3 A0A093F675 A0A093G4U5 A0A093HUZ5 A0A093IXZ4 A0A093JLK4 A0A093NLB8 A0A093QBH4 A0A093RAE7 A0A094KX95 A0A099YXC1 A0A0A0AP22 A0A0D9R387 A0A1S3ALV8 A0A1S3F7X9 A0A1U7Q4N7 A0A1U7TIZ2 A0A1V4KJ02 A0A218UWV9 A0A2I0LY83 A0A2I3GZD3 A0A2I3ST70 A0A2K5HWU4 A0A2K5MUV2 A0A2K5U1C8 A0A2K5Z6X6 A0A2K6BS25 A0A2K6EIG3 A0A2K6MGY8 A0A2K6PUD3 A0A2K6SSA8 B0BMT0 B4G1E1 C7AI81 D2GZ42 D2JYH4 F1P476 F2Z4N0 F7CW82 F7HJJ8 F7IH64 G1N8B9 G3RC70 G5BSZ9 H0VJI2 H0Y2B0 H9G3X4 I3MPZ1 K7FF29 M3W7A1 M3Y561 M7AXV5 P62736 P62737 P62738 P62739 P62740 Q5R5A2 U3I560 U3JYY8 W5PZK7
ENSPCAP00000006512 ENSOGAP00000022503 ENSP00000224784 ENSP00000402373 ENSAPLP00000002381 ENSECAP00000012964 ENSP00000224784 ENSCPOP00000010419 ENSOCUP00000007086 ENSDORP00000011922 ENSSSCP00000011135 ENSMPUP00000006462 ENSDORP00000011922 ENSPPYP00000023597 ENSCAFP00000023085 ENSFALP00000007992 ENSAMEP00000000963 ENSMPUP00000006462 ENSACAP00000000525 ENSAMEP00000000963 10090.ENSMUSP00000048218 10141.ENSCPOP00000010419 28377.ENSACAP00000000525 9361.ENSDNOP00000005207 9598.ENSPTRP00000020716 9600.ENSPPYP00000002849 9606.ENSP00000224784 9615.ENSCAFP00000023085 9796.ENSECAP00000012964 9823.ENSSSCP00000011135 9986.ENSOCUP00000007086 HGL_H00000224784-2 ENSCJAP00000010246 ENSCJAP00000043602 ENSP00000224784 ENSP00000402373 NP_001029674.1.59421 NP_001029674.1.76553 NP_001095152.1.1745 NP_001126814.1.23681 NP_001135417.1.87134 NP_001135417.1.92137 NP_001158122.1.46622 NP_001245001.1.72884 NP_001307784.1.87134 NP_001307784.1.92137 NP_001604.1.87134 NP_001604.1.92137 NP_031418.1.92730 NP_112266.1.100692 NP_112266.1.4139 XP_001141780.1.37143 XP_001142014.1.37143 XP_001503085.1.31192 XP_002756423.1.60252 XP_003224414.1.98722 XP_003255231.1.23891 XP_003473854.1.53824 XP_003505997.3.69978 XP_003783733.1.62490 XP_003810561.1.60992 XP_003922471.1.74449 XP_003993920.1.62641 XP_004020068.1.66739 XP_004049796.1.27298 XP_004279424.1.21590 XP_004279425.1.21590 XP_004279426.1.21590 XP_004322052.1.83887 XP_004369967.1.4749 XP_004409741.1.74151 XP_004440037.1.5094 XP_004464591.1.11602 XP_004583430.1.84141 XP_004607550.1.94378 XP_004632133.1.9945 XP_004680959.1.23501 XP_004701140.1.18182 XP_004780822.1.14098 XP_004858412.1.39548 XP_005029474.1.99704 XP_005048432.1.66865 XP_005063733.1.91757 XP_005144089.1.78019 XP_005225421.1.76553 XP_005292567.1.60341 XP_005339240.1.77405 XP_005352217.1.66349 XP_005385916.1.28644 XP_005416523.1.5688 XP_005481298.1.73095 XP_005503051.1.63277 XP_005520657.1.90289 XP_005565952.1.63531 XP_005698249.1.57651 XP_005897776.1.15283 XP_005897777.1.15283 XP_005969158.1.78601 XP_006058509.1.26621 XP_006121509.1.96668 XP_006147671.1.99106 XP_006188052.1.101512 XP_006211116.1.17985 XP_006831189.1.41390 XP_006880384.1.29581 XP_006926033.1.64745 XP_006984075.1.50099 XP_007071633.1.26238 XP_007079330.1.5354 XP_007101043.1.24612 XP_007179207.1.59432 XP_007179208.1.59432 XP_007470370.1.90284 XP_007470371.1.90284 XP_007537254.1.11023 XP_007633234.2.28591 XP_007961679.1.81039 XP_008056373.1.4292 XP_008151189.1.99482 XP_008168796.1.60341 XP_008500242.1.100939 XP_008529150.1.77740 XP_008642008.1.15636 XP_008687827.1.72690 XP_008836064.1.79516 XP_008928074.1.51550 XP_008928074.1.96775 XP_008943301.1.37566 XP_009008180.1.60252 XP_009073908.1.14518 XP_009085562.1.15306 XP_009276024.1.47732 XP_009318466.1.49731 XP_009463869.1.38621 XP_009506750.1.22320 XP_009568970.1.62272 XP_009574624.1.87690 XP_009640362.1.23211 XP_009676132.1.43253 XP_009676133.1.43253 XP_009676134.1.43253 XP_009702436.1.71050 XP_009809748.1.37116 XP_009862748.1.31609 XP_009887004.1.48241 XP_009896025.1.92783 XP_009915610.1.2804 XP_009933962.1.35112 XP_009948459.1.99599 XP_009965062.1.75343 XP_009987403.1.11325 XP_009998330.1.85724 XP_010012945.1.70042 XP_010081047.1.40768 XP_010124422.1.88979 XP_010134435.1.100080 XP_010158063.1.22856 XP_010171341.1.30499 XP_010177330.1.17318 XP_010225167.1.20684 XP_010293551.1.48707 XP_010304122.1.13389 XP_010377910.1.97406 XP_010409211.1.2935 XP_010563265.1.12557 XP_010603312.1.5607 XP_010836805.1.44457 XP_010969549.1.22495 XP_010994580.1.51371 XP_011216927.1.58354 XP_011574586.1.59079 XP_011574587.1.59079 XP_011738236.1.29376 XP_011803269.1.43180 XP_011803270.1.43180 XP_011803271.1.43180 XP_011853508.1.47321 XP_011853514.1.47321 XP_011918532.1.92194 XP_012015818.1.54773 XP_012310155.1.9421 XP_012361153.1.23891 XP_012361154.1.23891 XP_012421105.1.74151 XP_012515160.1.63892 XP_012515161.1.63892 XP_012515162.1.63892 XP_012620530.1.48125 XP_012872651.1.60039 XP_013049810.1.65836 XP_013049877.1.65836 XP_013155924.1.75256 XP_013155925.1.75256 XP_013155926.1.75256 XP_013155927.1.75256 XP_013802088.1.3284 XP_013838976.1.46622 XP_014142545.1.10750 XP_014142546.1.10750 XP_014142547.1.10750 XP_014142548.1.10750 XP_014682725.1.49734 XP_014730872.1.99236 XP_014811345.1.91963 XP_014934552.1.86478 XP_015143877.1.86415 XP_015143878.1.86415 XP_015280106.1.55130 XP_015311855.1.63531 XP_015354347.1.40921 XP_015488689.1.82291 XP_015722294.1.68032 XP_015984713.1.101085 XP_016076341.1.3490 XP_017521169.1.32401 XP_017722982.1.44346 XP_017924630.1.51550 XP_018766354.1.15306 XP_019285594.1.44245 XP_019473188.1.16129 XP_019489683.1.44202 XP_019489684.1.44202 XP_019594537.1.88060 XP_020026526.1.5219 XP_020656935.1.8467 XP_020751485.1.74333 XP_020829261.1.61212 XP_020829262.1.61212 XP_020927845.1.46622 XP_021075918.1.100879 XP_021256165.1.32913 XP_021256166.1.32913 XP_021256167.1.32913 XP_021395024.1.53032 XP_021513649.1.76796 XP_021551808.1.83697 XP_534781.2.84170 ENSSTOP00000013939 ENSPSIP00000006639 ENSOGAP00000022503 ENSNLEP00000014883 ENSSTOP00000013939 ENSCPOP00000010419 ENSMMUP00000012235 ENSFCAP00000006664 ENSDNOP00000005207 ENSMGAP00000008539 ENSPSIP00000006639 ENSBTAP00000036954 ENSBTAP00000046205 ENSTBEP00000015320 ENSMUSP00000048218 ENSGALP00000010239 ENSNLEP00000014883 ENSMUSP00000048218 ENSACAP00000000525 ENSOARP00000015893 ENSCAFP00000023085 ENSGGOP00000013092 ENSSSCP00000011135 ENSMGAP00000008539 ENSECAP00000012964 ENSPCAP00000006512 ENSCJAP00000010236 gi|213688375|ref|NP_001135417.1| gi|4501883|ref|NP_001604.1| ENSMUSP00000048218 ENSDNOP00000005207 ENSGGOP00000013092 ENSTBEP00000015320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]