SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4501887|ref|NP_001605.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4501887|ref|NP_001605.1|
Domain Number 1 Region: 149-374
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.34e-168
Family Actin/HSP70 0.0000682
Further Details:      
 
Domain Number 2 Region: 7-146
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.98e-104
Family Actin/HSP70 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4501887|ref|NP_001605.1|
Sequence length 375
Comment actin, cytoplasmic 2 [Homo sapiens]
Sequence
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
Download sequence
Identical sequences A0A098M0W7 A0A0B8RTA2 A0A0B8RZU4 A0A0S3NTB0 A0A1D9CF15 A0A1S3WQU9 A0A1W7RJN4 A0A218UL93 A0A226PMW1 A0A286XYY5 A0A2G9R467 A0A2H6MZN1 A0A2I2UC68 A0A2I3ST41 A0A2K5JX00 A0A2K5KLD7 A0A2K5QUG9 A0A2K5UPC4 A0A2K6A911 A0A2K6AT36 A0A2K6MAX2 A0A2K6NZM1 A2BDB0 D2I7P0 F6TII3 F7AAK7 F7DIB7 F7I0W8 G1RTV2 G3RDT6 G3T386 G5BJ63 H0WXK3 H2NV14 I3LVD5 J3S843 K7F239 L8HZP4 M3YJL1 M7AJL3 P63257 P63258 P63259 P63260 P63261 Q4KL81 Q5ZMQ2 T1DMJ3 U3FZL5 V8PI67
ENSMEUP00000014851 ENSOGAP00000007192 ENSMEUP00000014851 ENSMICP00000013549 ENSGGOP00000013697 ENSMUSP00000071486 ENSMUSP00000101822 ENSAMEP00000016912 ENSNLEP00000016676 ENSCPOP00000010883 ENSMPUP00000011518 ENSBTAP00000008132 ENSBTAP00000008132 ENSLAFP00000007683 ENSPSIP00000002099 ENSRNOP00000051859 ENSFCAP00000017132 HGL_H00000331514-3 6cxi_A 6cxi_B 6cxi_C 6cxi_D 6cxi_E 6cxj_A 6cxj_B 6cxj_C 6cxj_D 6cxj_E 6g2t_A 6g2t_B 6g2t_C 6g2t_D 6g2t_E 6g2t_F ENSMODP00000003213 ENSPCAP00000000771 ENSGALP00000042680 NP_001028790.1.59421 NP_001028790.1.76553 NP_001120921.1.100692 NP_001120921.1.4139 NP_001186883.1.87134 NP_001186883.1.92137 NP_001295542.1.86415 NP_001605.1.87134 NP_001605.1.92137 NP_033739.1.92730 WP_087507522.1.80426 XP_001370868.3.35504 XP_002729242.3.100692 XP_003274870.1.23891 XP_003274871.1.23891 XP_003357976.1.46622 XP_003417431.1.64505 XP_003464851.1.53824 XP_003496930.2.69978 XP_003786113.1.62490 XP_003831173.1.60992 XP_004013127.3.66739 XP_004040872.1.27298 XP_004275611.1.21590 XP_004432908.1.5094 XP_004655321.1.11716 XP_004695563.1.23501 XP_005350909.1.66349 XP_005905452.1.15283 XP_005963829.1.78601 XP_006134922.1.96668 XP_006172147.2.99106 XP_006199509.1.17985 XP_006869574.1.41390 XP_006940721.2.62641 XP_007070993.1.26238 XP_007125705.1.24612 XP_007419915.2.37977 XP_007462391.1.90284 XP_007957779.1.48129 XP_008011433.1.81039 XP_008102340.2.98722 XP_008567052.1.73410 XP_008987529.1.60252 XP_009250409.1.23681 XP_010226323.1.20684 XP_010352583.1.97406 XP_010576860.1.12557 XP_010595197.1.64505 XP_010948971.1.22495 XP_010997836.1.51371 XP_011216383.1.58354 XP_011585049.1.59079 XP_011718490.1.29376 XP_011815535.1.43180 XP_011815598.1.43180 XP_011848881.1.47321 XP_011848965.1.47321 XP_011921552.1.92194 XP_011964823.2.54773 XP_012308165.1.9421 XP_012511818.1.63892 XP_012644914.1.48125 XP_012909756.1.14098 XP_012933617.1.39548 XP_013361520.1.28644 XP_013806576.1.3284 XP_013921350.1.67126 XP_014593357.1.31192 XP_014644845.1.5094 XP_014719674.1.49734 XP_014719683.1.49734 XP_014742958.1.99236 XP_014806967.1.91963 XP_014941164.1.86478 XP_014976066.1.72884 XP_014976068.1.72884 XP_014976069.1.72884 XP_015135388.1.86415 XP_015264215.1.55130 XP_015501205.1.82291 XP_015670662.1.16292 XP_016048746.1.11023 XP_016070943.1.3490 XP_016786157.1.37143 XP_017380370.1.71028 XP_017452655.1.100692 XP_017536125.1.32401 XP_017667527.1.3805 XP_017734769.1.44346 XP_017919092.1.57651 XP_018423728.1.44173 XP_019321482.1.44245 XP_019342030.1.47583 XP_019371339.1.87953 XP_019397841.1.79039 XP_019517489.1.44202 XP_019591248.1.88060 XP_019796283.1.83887 XP_019837062.1.53367 XP_020043675.1.5219 XP_020762125.1.74333 XP_020856456.1.61212 XP_021270110.1.32913 XP_021270111.1.32913 XP_021389849.1.53032 XP_021536589.1.83697 ENSPPYP00000009805 ENSMICP00000013549 ENSSSCP00000028087 gi|316659409|ref|NP_001186883.1| gi|4501887|ref|NP_001605.1| ENSGGOP00000013697 ENSPSIP00000002099 ENSCPOP00000010883 ENSPCAP00000000771 ENSECAP00000016124 10116.ENSRNOP00000051859 10141.ENSCPOP00000010883 13616.ENSMODP00000003213 9600.ENSPPYP00000009805 9606.ENSP00000331514 9796.ENSECAP00000016124 9913.ENSBTAP00000008132 ENSPPYP00000009805 ENSMODP00000003213 ENSSSCP00000028087 ENSECAP00000016124 gi|122936374|gb|AAI30156| gi|134035381|gb|A2BDB0| gi|147901470|ref|NP_001091279| ENSCJAP00000005237 ENSP00000331514 ENSP00000458162 ENSP00000458435 ENSP00000459124 ENSP00000461672 ENSP00000477968 ENSMUSP00000071486 ENSP00000331514 ENSP00000458162 ENSP00000458435 ENSP00000459124 ENSP00000461672 ENSP00000469093 ENSP00000470102 ENSP00000470446 ENSP00000471522 ENSP00000472125 ENSOGAP00000007192 ENSCJAP00000005237 ENSMPUP00000011518 ENSAMEP00000016912 ENSNLEP00000016676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]