SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4501889|ref|NP_001606.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4501889|ref|NP_001606.1|
Domain Number 1 Region: 148-376
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.72e-99
Family Actin/HSP70 0.00000000106
Further Details:      
 
Domain Number 2 Region: 5-154
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.3e-66
Family Actin/HSP70 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4501889|ref|NP_001606.1|
Sequence length 376
Comment actin, gamma-enteric smooth muscle isoform 1 precursor [Homo sapiens]
Sequence
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD
LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKS
YELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
PEYDEAGPSIVHRKCF
Download sequence
Identical sequences A0A091IFD5 A0A096NZ53 A0A0D9RSK3 A0A0Q3MIQ7 A0A151LY75 A0A1S2ZGG3 A0A1S3GPA5 A0A1U7QQT3 A0A1U7S4V2 A0A1U7TXI2 A0A226MFL3 A0A226P5C7 A0A286Y461 A0A286ZWJ1 A0A2I2YVV7 A0A2I3G1L5 A0A2I3SEJ6 A0A2J8XBH9 A0A2K5F8R2 A0A2K5KDW5 A0A2K5P7U6 A0A2K5QAD6 A0A2K6A7U9 A0A2K6E5F2 A0A2K6GEM1 A0A2K6LPB1 A0A2K6RD88 A0A2K6U9P1 D2HH73 F2Z4N8 F6UA63 F6Z8K0 F7HY33 G1NTM6 G1SK59 G3T9R8 G5AXH0 G7PMI2 H0WU76 I3MMT4 K7FGA7 L5M462 L7MZG9 L8IFL5 L9KM54 M3WGC1 P63267 P63268 P63269 P63270 Q3UJ36 Q5E9B5 R0LKA2 U3IEJ7 W5PRA1
ENSCPOP00000006171 ENSSTOP00000012878 ENSAPLP00000005669 ENSMUSP00000074658 gi|4501889|ref|NP_001606.1| ENSOARP00000012979 ENSAMEP00000018371 ENSNLEP00000000377 ENSP00000295137 ENSP00000386857 ENSP00000387182 ENSMLUP00000000528 ENSTTRP00000006801 ENSCJAP00000033026 HGL_H00000295137 ENSGGOP00000003925 ENSCAFP00000012881 ENSMUSP00000074658 ENSPANP00000018371 ENSCPOP00000006171 ENSMUSP00000074658 ENSMUSP00000113552 ENSACAP00000001688 ENSFCAP00000011225 ENSECAP00000016551 ENSOCUP00000003176 ENSPSIP00000007067 ENSLAFP00000010557 ENSMMUP00000023266 ENSRNOP00000050322 ENSLAFP00000010557 ENSOGAP00000005756 ENSECAP00000016551 ENSMMUP00000023266 ENSGGOP00000003925 ENSDNOP00000025344 NP_001013610.1.59421 NP_001013610.1.76553 NP_001606.1.87134 NP_001606.1.92137 NP_033740.2.92730 NP_037025.1.100692 NP_037025.1.4139 NP_990503.1.86415 XP_001152416.2.37143 XP_001487936.1.31192 XP_002757651.1.60252 XP_002921532.1.58354 XP_003228277.1.98722 XP_003268722.1.23891 XP_003268723.1.23891 XP_003413731.1.64505 XP_003469038.1.53824 XP_003810405.1.60992 XP_003810406.1.60992 XP_003984178.1.62641 XP_004006130.1.66739 XP_004029489.1.27298 XP_004029490.1.27298 XP_004277131.1.21590 XP_004369249.1.4749 XP_004398759.1.74151 XP_004435577.1.5094 XP_004482119.1.11602 XP_004590728.1.84141 XP_004634153.1.9945 XP_004634154.1.9945 XP_004691592.1.23501 XP_004696151.1.18182 XP_004844768.1.39548 XP_005018461.1.99704 XP_005071114.1.91757 XP_005234290.1.75256 XP_005314164.1.60341 XP_005329403.1.77405 XP_005364709.1.66349 XP_005385592.1.28644 XP_005575634.1.63531 XP_005686409.1.57651 XP_005869480.1.60319 XP_005897700.1.15283 XP_005897701.1.15283 XP_005962710.1.78601 XP_005962711.1.78601 XP_006031213.1.24877 XP_006046012.1.26621 XP_006096839.1.53796 XP_006129170.1.96668 XP_006129171.1.96668 XP_006151301.1.99106 XP_006236790.1.100692 XP_006278798.1.47583 XP_006760090.1.95426 XP_006872463.1.41390 XP_006880916.1.29581 XP_006905249.1.64745 XP_006994414.1.50099 XP_007067505.1.26238 XP_007083507.1.5354 XP_007120145.1.24612 XP_007120146.1.24612 XP_007120147.1.24612 XP_007189067.1.59432 XP_007430931.1.37977 XP_007459448.1.90284 XP_007459449.1.90284 XP_007519006.1.11023 XP_007519007.1.11023 XP_007950812.1.48129 XP_007968389.1.81039 XP_008062575.1.4292 XP_008145657.1.99482 XP_008498953.1.100939 XP_008531892.1.77740 XP_008578107.1.73410 XP_008698225.1.72690 XP_008698226.1.72690 XP_008698227.1.72690 XP_008851085.1.79516 XP_008924542.2.51550 XP_010002223.1.85724 XP_010002224.1.85724 XP_010331749.1.74449 XP_010331750.1.74449 XP_010331751.1.74449 XP_010380028.1.97406 XP_010561162.1.12557 XP_010629837.1.5607 XP_010629838.1.5607 XP_010726469.1.16129 XP_010828041.1.44457 XP_010950737.1.22495 XP_010987230.1.51371 XP_011356440.1.92234 XP_011573592.1.59079 XP_011573593.1.59079 XP_011711925.1.29376 XP_011801426.1.43180 XP_011836089.1.47321 XP_011939699.1.92194 XP_011978985.1.54773 XP_012307626.1.9421 XP_012391113.1.21590 XP_012417231.1.74151 XP_012513656.1.63892 XP_012587014.1.23501 XP_012644119.2.48125 XP_012662864.1.62490 XP_012890094.1.60039 XP_013208316.1.66349 XP_013208317.1.66349 XP_013215822.1.77405 XP_014407364.1.101512 XP_014685310.1.49734 XP_014747597.1.99236 XP_014800963.1.91963 XP_014800964.1.91963 XP_014919527.1.86478 XP_014968149.1.72884 XP_015278519.1.55130 XP_015355281.1.40921 XP_015843321.1.50099 XP_015843322.1.50099 XP_015986194.1.101085 XP_016058060.1.3490 XP_017196134.1.1745 XP_017364173.1.71028 XP_017364174.1.71028 XP_017499844.1.32401 XP_017499845.1.32401 XP_017717342.1.44346 XP_019297575.1.44245 XP_019336714.1.47583 XP_019369925.1.87953 XP_019479066.1.44202 XP_019568438.1.88060 XP_019568439.1.88060 XP_020022008.1.5219 XP_020141787.1.48125 XP_020635780.1.8467 XP_020751672.1.74333 XP_020943030.1.46622 XP_021047426.1.100879 XP_021230591.1.32913 XP_021554781.1.83697 XP_021554783.1.83697 XP_533002.2.84170 ENSMLUP00000000528 ENSAMEP00000018371 ENSFCAP00000011225 ENSPSIP00000007067 ENSOGAP00000005756 ENSACAP00000001688 10090.ENSMUSP00000113552 10141.ENSCPOP00000006171 28377.ENSACAP00000001688 9544.ENSMMUP00000023266 9598.ENSPTRP00000020714 9606.ENSP00000295137 9615.ENSCAFP00000012881 9685.ENSFCAP00000011225 9796.ENSECAP00000016551 9986.ENSOCUP00000003176 ENSP00000295137 ENSP00000386857 ENSCAFP00000012881 ENSSTOP00000012878 ENSTTRP00000006801 ENSCJAP00000033026 ENSCJAP00000043912 ENSNLEP00000000376 ENSOCUP00000003176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]