SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4502511|ref|NP_001728.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4502511|ref|NP_001728.1|
Domain Number 1 Region: 103-134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000471
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 41-89
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000432
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 3 Region: 73-119,505-540
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000157
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4502511|ref|NP_001728.1|
Sequence length 559
Comment complement component C9 precursor [Homo sapiens]
Sequence
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCN
GDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAIS
LKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIY
VLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLV
PVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACE
ISKQKISEGLPALEFPNEK
Download sequence
Identical sequences P02748
ENSP00000263408 GO.42183 ENSP00000263408 ENSP00000263408 gi|4502511|ref|NP_001728.1| NP_001728.1.87134 NP_001728.1.92137 9606.ENSP00000263408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]