SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4502703|ref|NP_001245.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4502703|ref|NP_001245.1|
Domain Number 1 Region: 167-408
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-41
Family Extended AAA-ATPase domain 0.002
Further Details:      
 
Domain Number 2 Region: 453-554
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.67e-20
Family Helicase DNA-binding domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4502703|ref|NP_001245.1|
Sequence length 560
Comment cell division control protein 6 homolog [Homo sapiens]
Sequence
MPQTRSQAQATISFPKRKLSRALNKAKNSSDAKLEPTNVQTVTCSPRVKALPLSPRKRLG
DDNLCNTPHLPPCSPPKQGKKENGPPHSHTLKGRRLVFDNQLTIKSPSKRELAKVHQNKI
LSSVRKSQEITTNSEQRCPLKKESACVRLFKQEGTCYQQAKLVLNTAVPDRLPAREREMD
VIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQ
AVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTL
FEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLN
QVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSP
SEPLIPKRVGLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEV
TLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKE
IEHALKDKALIGNILATGLP
Download sequence
Identical sequences A0A024R1S2 Q99741
ENSP00000209728 gi|4502703|ref|NP_001245.1| ENSP00000209728 9606.ENSP00000209728 HR2975 ENSP00000209728 NP_001245.1.87134 NP_001245.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]