SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4503635|ref|NP_000497.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4503635|ref|NP_000497.1|
Domain Number 1 Region: 339-618
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.23e-87
Family Eukaryotic proteases 0.000000000282
Further Details:      
 
Domain Number 2 Region: 103-197
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.00000771
Further Details:      
 
Domain Number 3 Region: 209-297
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-27
Family Kringle modules 0.00000612
Further Details:      
 
Domain Number 4 Region: 43-104
Classification Level Classification E-value
Superfamily GLA-domain 7.91e-20
Family GLA-domain 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4503635|ref|NP_000497.1|
Sequence length 622
Comment prothrombin preproprotein [Homo sapiens]
Sequence
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
Download sequence
Identical sequences P00734
ENSP00000308541 ENSP00000308541 gi|4503635|ref|NP_000497.1| NP_000497.1.87134 NP_000497.1.92137 ENSP00000308541 9606.ENSP00000308541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]