SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4504007|ref|NP_000158.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4504007|ref|NP_000158.1|
Domain Number 1 Region: 13-269
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.16e-81
Family Glycerol kinase 0.00000101
Further Details:      
 
Domain Number 2 Region: 268-514
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.03e-74
Family Glycerol kinase 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4504007|ref|NP_000158.1|
Sequence length 524
Comment glycerol kinase isoform b [Homo sapiens]
Sequence
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIY
GLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLS
AVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP
Download sequence
Identical sequences A0A2K6D8U8 K7AFN1
ENSP00000368228 gi|4504007|ref|NP_000158.1| ENSP00000368228 NP_000158.1.87134 NP_000158.1.92137 XP_003261229.1.23891 XP_003317451.1.37143 XP_004064001.1.27298 XP_007989548.1.81039 XP_011754180.1.29376 XP_011826084.1.47321 XP_011890978.1.92194 XP_014982620.1.72884 XP_015299043.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]