SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4504657|ref|NP_003844.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4504657|ref|NP_003844.1|
Domain Number 1 Region: 399-563
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.22e-24
Family Toll/Interleukin receptor TIR domain 0.00081
Further Details:      
 
Domain Number 2 Region: 254-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000944
Family I set domains 0.028
Further Details:      
 
Domain Number 3 Region: 163-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000233
Family I set domains 0.018
Further Details:      
 
Weak hits

Sequence:  gi|4504657|ref|NP_003844.1|
Domain Number - Region: 76-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00733
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4504657|ref|NP_003844.1|
Sequence length 599
Comment interleukin-18 receptor accessory protein precursor [Homo sapiens]
Sequence
MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRN
RLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNN
SGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSC
QSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV
RTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
SVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL
LYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF
PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFI
LSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWR
GLKSVPPNSRFWAKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW
Download sequence
Identical sequences O95256
NYSGRC-IgSF-I18RA_HUMAN ENSP00000264260 NP_003844.1.87134 NP_003844.1.92137 ENSP00000264260 gi|4504657|ref|NP_003844.1| ENSP00000264260 9606.ENSP00000264260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]