SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4505577|ref|NP_002561.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4505577|ref|NP_002561.1|
Domain Number 1 Region: 158-491
Classification Level Classification E-value
Superfamily Subtilisin-like 3.01e-93
Family Subtilases 0.000000000842
Further Details:      
 
Domain Number 2 Region: 487-637
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-41
Family Proprotein convertase P-domain 0.0002
Further Details:      
 
Domain Number 3 Region: 693-857
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.07e-34
Family Growth factor receptor domain 0.00034
Further Details:      
 
Domain Number 4 Region: 70-141
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 3.91e-25
Family Prohormone convertase 1 pro-domain 0.0025
Further Details:      
 
Domain Number 5 Region: 832-941
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000541
Family Growth factor receptor domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4505577|ref|NP_002561.1|
Sequence length 969
Comment proprotein convertase subtilisin/kexin type 6 isoform a preproprotein [Homo sapiens]
Sequence
MPPRAPPAPGPRPPPRAAAATDTAAGAGGAGGAGGAGGPGFRPLAPRPWRWLLLLALPAA
CSAPPPRPVYTNHWAVQVLGGPAEADRVAAAHGYLNLGQIGNLEDYYHFYHSKTFKRSTL
SSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALYFNDPIWSNMWYLHCGDKNSRC
RSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNYDSYASYDVNGNDYDPSPRYDA
SNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRMLDGDVTDVVEAKSLGIRPNYID
IYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGSIFVWASGNGGREGDYCSCDGY
TNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFYERKIVTTDLRQRCTDGHTGTS
VSAPMVAGIIALALEANSQLTWRDVQHLLVKTSRPAHLKASDWKVNGAGHKVSHFYGFGL
VDAEALVVEAKKWTAVPSQHMCVAASDKRPRSIPLVQVLRTTALTSACAEHSDQRVVYLE
HVVVRTSISHPRRGDLQIYLVSPSGTKSQLLAKRLLDLSNEGFTNWEFMTVHCWGEKAEG
QWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLELSAPELEPP
KAALSPSQVEVPEDEEDYTAQSTPGSANILQTSVCHPECGDKGCDGPNADQCLNCVHFSL
GSVKTSRKCVSVCPLGYFGDTAARRCRRCHKGCETCSSRAATQCLSCRRGFYHHQEMNTC
VTLCPAGFYADESQKNCLKCHPSCKKCVDEPEKCTVCKEGFSLARGSCIPDCEPGTYFDS
ELIRCGECHHTCGTCVGPGREECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRR
CDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQF
CCRTCLLAG
Download sequence
Identical sequences P29122
NP_002561.1.87134 NP_002561.1.92137 gi|4505577|ref|NP_002561.1| ENSP00000482760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]