SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4505579|ref|NP_002560.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4505579|ref|NP_002560.1|
Domain Number 1 Region: 110-441
Classification Level Classification E-value
Superfamily Subtilisin-like 8.38e-98
Family Subtilases 0.00000000000495
Further Details:      
 
Domain Number 2 Region: 435-574
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.4e-42
Family Proprotein convertase P-domain 0.00000035
Further Details:      
 
Domain Number 3 Region: 30-100
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 6.46e-24
Family Prohormone convertase 1 pro-domain 0.0028
Further Details:      
 
Domain Number 4 Region: 585-676
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000557
Family Growth factor receptor domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4505579|ref|NP_002560.1|
Sequence length 794
Comment furin preproprotein [Homo sapiens]
Sequence
MELRPWLLWVVAATGTLVLLAADAQGQKVFTNTWAVRIPGGPAVANSVARKHGFLNLGQI
FGDYYHFWHRGVTKRSLSPHRPRHSRLQREPQVQWLEQQVAKRRTKRDVYQEPTDPKFPQ
QWYLSGVTQRDLNVKAAWAQGYTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDP
DPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRMLDGEVTDAVEARSL
GLNPNHIHIYSASWGPEDDGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREH
DSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNEKQIVTTDLRQKC
TESHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLVVQTSKPAHLNANDWATNGVGRKV
SHSYGYGLLDAGAMVALAQNWTTVAPQRKCIIDILTEPKDIGKRLEVRKTVTACLGEPNH
ITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADGFNDWAFMTTHSWD
EDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPVPPESSGCKTLTSSQACVVCE
EGFSLHQKSCVQHCPPGFAPQVLDTHYSTENDVETIRASVCAPCHASCATCQGPALTDCL
SCPSHASLDPVEQTCSRQSQSSRESPPQQQPPRLPPEVEAGQRLRAGLLPSHLPEVVAGL
SCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPPEAWQEECPSDSEEDEG
RGERTAFIKDQSAL
Download sequence
Identical sequences A0A024RC70 P09958
ENSP00000268171 NP_001276752.1.87134 NP_001276752.1.92137 NP_001276753.1.87134 NP_001276753.1.92137 NP_002560.1.87134 NP_002560.1.92137 9606.ENSP00000268171 gi|4505579|ref|NP_002560.1| ENSP00000268171 ENSP00000268171 ENSP00000483552 ENSP00000484952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]