SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4505581|ref|NP_003681.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4505581|ref|NP_003681.1|
Domain Number 1 Region: 123-200
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 6.76e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.00013
Further Details:      
 
Domain Number 2 Region: 31-100
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 5.81e-19
Family Double-stranded RNA-binding domain (dsRBD) 0.0000294
Further Details:      
 
Domain Number 3 Region: 229-307
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000000117
Family Double-stranded RNA-binding domain (dsRBD) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4505581|ref|NP_003681.1|
Sequence length 313
Comment interferon-inducible double stranded RNA-dependent protein kinase activator A isoform 1 [Homo sapiens]
Sequence
MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQ
IHVPTFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQ
PKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQA
KRNAAEKFLAKFSNISPENHISLTNVVGHSLGCTWHSLRNSPGEKINLLKRSLLSIPNTD
YIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAH
NALQYLKIIAERK
Download sequence
Identical sequences A0A096NQ26 A0A2J8VRD4 A0A2K5LXP9 A0A2K5WED7 A0A2K6BUM1 H2QJ21 H9G158 O75569
gi|4505581|ref|NP_003681.1| ENSPANP00000015117 9544.ENSMMUP00000002913 9598.ENSPTRP00000021685 9606.ENSP00000318176 ENSP00000318176 ENSPTRP00000021685 ENSMMUP00000002913 ENSPTRP00000021685 ENSNLEP00000007449 ENSP00000318176 ENSP00000318176 GO.36680 hss001000506.2 ENSNLEP00000007449 ENSMMUP00000002913 NP_001247776.1.72884 NP_003681.1.87134 NP_003681.1.92137 XP_003253827.1.23891 XP_003815560.1.60992 XP_005573656.1.63531 XP_007963658.1.81039 XP_009441943.1.37143 XP_011717764.1.29376 XP_011847213.1.47321 XP_011902510.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]