SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4506001|ref|NP_000300.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506001|ref|NP_000300.1|
Domain Number 1 Region: 5-326,439-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.86e-49
Family FAD-linked reductases, N-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 312-421
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.35e-22
Family L-aminoacid/polyamine oxidase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506001|ref|NP_000300.1|
Sequence length 477
Comment protoporphyrinogen oxidase [Homo sapiens]
Sequence
MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRG
IRPAGALGARTLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGRTPQPDSALIRQALAERWSQWSLRGGLEMLPQAL
ETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEADHVISAIPASVLSELLPAEAA
PLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP
QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
Download sequence
Identical sequences A0A2I3SYH2 P50336
ENSPTRP00000002638 ENSP00000343943 9598.ENSPTRP00000002638 9606.ENSP00000343943 gi|170650615|ref|NP_001116236.1| gi|4506001|ref|NP_000300.1| NP_000300.1.87134 NP_000300.1.92137 NP_001116236.1.87134 NP_001116236.1.92137 XP_001173380.1.37143 XP_001173395.1.37143 ENSPTRP00000002638 3nks_A ENSP00000343943 ENSP00000356978 GO.38135 HR6724 ENSP00000343943 ENSP00000356978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]