SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4506103|ref|NP_002750.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506103|ref|NP_002750.1|
Domain Number 1 Region: 259-536
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-66
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 11-79
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.49e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0000229
Further Details:      
 
Domain Number 3 Region: 88-167
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.36e-17
Family Double-stranded RNA-binding domain (dsRBD) 0.00000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506103|ref|NP_002750.1|
Sequence length 551
Comment interferon-induced, double-stranded RNA-activated protein kinase isoform a [Homo sapiens]
Sequence
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC
Download sequence
Identical sequences P19525
ENSP00000233057 ENSP00000378559 NP_001129123.1.87134 NP_001129123.1.92137 NP_002750.1.87134 NP_002750.1.92137 XP_011531289.1.92137 ENSP00000233057 9606.ENSP00000233057 ENSP00000233057 ENSP00000378559 gi|208431827|ref|NP_001129123.1| gi|4506103|ref|NP_002750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]