SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4506137|ref|NP_000942.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506137|ref|NP_000942.1|
Domain Number 1 Region: 51-104
Classification Level Classification E-value
Superfamily GLA-domain 1.06e-19
Family GLA-domain 0.00068
Further Details:      
 
Weak hits

Sequence:  gi|4506137|ref|NP_000942.1|
Domain Number - Region: 164-173
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0759
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506137|ref|NP_000942.1|
Sequence length 202
Comment transmembrane gamma-carboxyglutamic acid protein 2 precursor [Homo sapiens]
Sequence
MRGHPSLLLLYMALTTCLDTSPSEETDQEVFLGPPEAQSFLSSHTRIPRANHWDLELLTP
GNLERECLEERCSWEEAREYFEDNTLTERFWESYIYNGKGGRGRVDVASLAVGLTGGILL
IVLAGLGAFWYLRWRQHRGQQPCPQEAGLISPLSPLNPLGPPTPLPPPPPPPPGLPTYEQ
ALAASGVHDAPPPPYTSLRRPH
Download sequence
Identical sequences O14669
ENSP00000246794 9606.ENSP00000246794 gi|4506137|ref|NP_000942.1| NP_000942.1.87134 NP_000942.1.92137 XP_006723349.1.92137 ENSP00000246794 ENSP00000246794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]