SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4506447|ref|NP_002888.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4506447|ref|NP_002888.1|
Domain Number 1 Region: 29-123
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.1e-23
Family Canonical RBD 0.0000845
Further Details:      
 
Domain Number 2 Region: 131-248
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.7e-20
Family Canonical RBD 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4506447|ref|NP_002888.1|
Sequence length 403
Comment RNA-binding motif, single-stranded-interacting protein 1 isoform c [Homo sapiens]
Sequence
MGKVWKQQMYPQYATYYYPQYLQAKQSLVPAHPMAPPSPSTTSSNNNSSSSSNSGWDQLS
KTNLYIRGLPPHTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPAAAQKAV
SALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQELENMLKPFGQVISTRILRDSSGTS
RGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQKKRQNPNKYIPN
GRPWHREGEAGMTLTYDPTTAAIQNGFYPSPYSIATNRMITQTSITPYIASPVSAYQVQS
PSWMQPQPYILQHPGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTGTYMPATSAMQ
GAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQPNK
Download sequence
Identical sequences A0A0S2Z499 K7B2E0
NP_002888.1.87134 NP_002888.1.92137 XP_003266207.1.23891 XP_515853.3.37143 gi|4506447|ref|NP_002888.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]