SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4507145|ref|NP_003785.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4507145|ref|NP_003785.1|
Domain Number 1 Region: 59-186
Classification Level Classification E-value
Superfamily PX domain 4.84e-27
Family PX domain 0.001
Further Details:      
 
Weak hits

Sequence:  gi|4507145|ref|NP_003785.1|
Domain Number - Region: 229-342
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00282
Family BAR domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4507145|ref|NP_003785.1|
Sequence length 450
Comment sorting nexin-4 [Homo sapiens]
Sequence
MEQAPPDPERQLQPAPLEPLGSPDAGLGAAVGKEAEGAGEESSGVDTMTHNNFWLKKIEI
SVSEAEKRTGRNAMNMQETYTAYLIETRSVEHTDGQSVLTDSLWRRYSEFELLRSYLLVY
YPHIVVPPLPEKRAEFVWHKLSADNMDPDFVERRRIGLENFLLRIASHPILCRDKIFYLF
LTQEGNWKETVNETGFQLKADSRLKALNATFRVKNPDKRFTDLKHYSDELQSVISHLLRV
RARVADRLYGVYKVHGNYGRVFSEWSAIEKEMGDGLQSAGHHMDVYASSIDDILEDEEHY
ADQLKEYLFYAEALRAVCRKHELMQYDLEMAAQDLASKKQQCEELVTGTVRTFSLKGMTT
KLFGQETPEQREARIKVLEEQINEGEQQLKSKNLEGREFVKNAWADIERFKEQKNRDLKE
ALISYAVMQISMCKKGIQVWTNAKECFSKM
Download sequence
Identical sequences H2QN95 O95219
9598.ENSPTRP00000026413 9606.ENSP00000251775 ENSPTRP00000026413 ENSP00000251775 gi|4507145|ref|NP_003785.1| ENSP00000251775 GO.36851 HR4477 hsi002014878.1 ENSP00000251775 NP_003785.1.87134 NP_003785.1.92137 XP_001169563.2.37143 ENSPTRP00000026413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]