SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|45359846|ref|NP_987100.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45359846|ref|NP_987100.1|
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily NTF2-like 3.02e-36
Family NTF2-like 0.0029
Further Details:      
 
Domain Number 2 Region: 294-405
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.46e-19
Family Canonical RBD 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|45359846|ref|NP_987100.1|
Sequence length 449
Comment ras GTPase-activating protein-binding protein 2 isoform b [Homo sapiens]
Sequence
MVMEKPSPLLVGREFVRQYYTLLNKAPEYLHRFYGRNSSYVHGGVDASGKPQEAVYGQND
IHHKVLSLNFSECHTKIRHVDAHATLSDGVVVQVMGLLSNSGQPERKFMQTFVLAPEGSV
PNKFYVHNDMFRYEDEVFGDSEPELDEESEDEVEEEQEERQPSPEPVQENANSGYYEAHP
VTNGIEEPLEESSHEPEPEPESETKTEELKPQVEEKNLEELEEKSTTPPPAEPVSLPQEP
PKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDSDNRRIIRYPDSHQL
FVGNLPHDIDENELKEFFMSFGNVVELRINTKGVGGKLPNFGFVVFDDSEPVQRILIAKP
IMFRGEVRLNVEEKKTRAARERETRGGGDDRRDIRRNDRGPGGPRGIVGGGMMRDRDGRG
PPPRGGMAQKLGSGRGTGQMEGRFTGQRR
Download sequence
Identical sequences A0A024RDB2 A0A096MT67 A0A0D9QXD5 A0A2I2YGD8 A0A2J8UU40 A0A2K5JB45 A0A2K5L6G1 A0A2K5VPF7 A0A2K5XW10 K7D3K3
NP_987100.1.87134 NP_987100.1.92137 XP_003310383.1.37143 XP_003832359.1.60992 XP_005555092.1.63531 XP_007997112.1.81039 XP_009238367.1.23681 XP_009238368.1.23681 XP_011821573.1.47321 XP_011895800.1.92194 XP_011895801.1.92194 XP_016864367.1.92137 XP_016864368.1.92137 XP_017202978.1.1745 XP_018880878.1.27298 gi|45359846|ref|NP_987100.1| ENSP00000350518 ENSPANP00000002991 ENSP00000350518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]