SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|45439325|ref|NP_982297.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45439325|ref|NP_982297.1|
Domain Number 1 Region: 35-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-40
Family Galectin (animal S-lectin) 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|45439325|ref|NP_982297.1|
Sequence length 168
Comment placental protein 13-like isoform 2 [Homo sapiens]
Sequence
MSLTHRLHLCKYWGCAVSNVCRFWEGRPLPLMIVVPYTLPVSLPVGSCVIITGTPILTFV
KDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFEL
CIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD
Download sequence
Identical sequences ENSP00000353893 NP_982297.1.87134 NP_982297.1.92137 9606.ENSP00000353893 ENSP00000353893 ENSP00000375905 gi|45439325|ref|NP_982297.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]