SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4557735|ref|NP_000231.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4557735|ref|NP_000231.1|
Domain Number 1 Region: 13-319,423-463
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.77e-76
Family FAD-linked reductases, N-terminal domain 0.000000000657
Further Details:      
 
Domain Number 2 Region: 299-409
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.42e-37
Family L-aminoacid/polyamine oxidase 0.000000521
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4557735|ref|NP_000231.1|
Sequence length 527
Comment amine oxidase [flavin-containing] A [Homo sapiens]
Sequence
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Download sequence
Identical sequences P21397 Q53YE7
NP_000231.1.87134 NP_000231.1.92137 2bxr_A 2bxr_B 2bxs_A 2bxs_B ENSP00000340684 gi|4557735|ref|NP_000231.1| ENSP00000340684 P21397 ENSP00000340684 9606.ENSP00000340684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]