SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|45935393|ref|NP_079215.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45935393|ref|NP_079215.2|
Domain Number 1 Region: 462-551
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-16
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 2 Region: 241-331
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000019
Family Canonical RBD 0.0007
Further Details:      
 
Domain Number 3 Region: 344-437
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000151
Family Canonical RBD 0.001
Further Details:      
 
Domain Number 4 Region: 51-191
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000303
Family DnaQ-like 3'-5' exonuclease 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|45935393|ref|NP_079215.2|
Sequence length 717
Comment epithelial splicing regulatory protein 2 [Homo sapiens]
Sequence
MTPPPPPPPPPGPDPAADPAADPCPWPGSLVVLFGATAGALGRDLGSDETDLILLVWQVV
EPRSRQVGTLHKSLVRAEAAALSTQCREASGLSADSLARAEPLDKVLQQFSQLVNGDVAL
LGGGPYMLCTDGQQLLRQVLHPEASRKNLVLPDMFFSFYDLRREFHMQHPSTCPARDLTV
ATMAQGLGLETDATEDDFGVWEVKTMVAVILHLLKEPSSQLFSKPEVIKQKYETGPCSKA
DVVDSETVVRARGLPWQSSDQDVARFFKGLNVARGGVALCLNAQGRRNGEALIRFVDSEQ
RDLALQRHKHHMGVRYIEVYKATGEEFVKIAGGTSLEVARFLSREDQVILRLRGLPFSAG
PTDVLGFLGPECPVTGGTEGLLFVRHPDGRPTGDAFALFACEELAQAALRRHKGMLGKRY
IELFRSTAAEVQQVLNRYASGPLLPTLTAPLLPIPFPLAPGTGRDCVRLRGLPYTATIED
ILSFLGEAAADIRPHGVHMVLNQQGRPSGDAFIQMTSAERALAAAQRCHKKVMKERYVEV
VPCSTEEMSRVLMGGTLGRSGMSPPPCKLPCLSPPTYTTFQATPTLIPTETAALYPSSAL
LPAARVPAAPTPVAYYPGPATQLYLNYTAYYPSPPVSPTTVGYLTTPTAALASAPTSVLS
QSGALVRMQGVPYTAGMKDLLSVFQAYQLPADDYTSLMPVGDPPRTVLQAPKEWVCL
Download sequence
Identical sequences ENSP00000418748 9606.ENSP00000418748 ENSP00000418748 NP_079215.2.87134 NP_079215.2.92137 gi|45935393|ref|NP_079215.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]