SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46397308|ref|NP_997010.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46397308|ref|NP_997010.1|
Domain Number 1 Region: 13-308
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.13e-36
Family FAD-linked reductases, N-terminal domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46397308|ref|NP_997010.1|
Sequence length 325
Comment polyamine oxidase isoform 2 [Homo sapiens]
Sequence
MESTGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERCF
GGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGA
SVSLQLVAEMATLFYGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLK
LAVLNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMAALPEDT
VVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHHVIVTVPLGLSTFSVGSLP
DLSLSSWRLCRMKKYFCVSPKCSGE
Download sequence
Identical sequences ENSP00000348654 ENSP00000435514 ENSP00000348654 ENSP00000435514 NP_997010.1.87134 NP_997010.1.92137 gi|46397308|ref|NP_997010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]