SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46397310|ref|NP_997011.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46397310|ref|NP_997011.1|
Domain Number 1 Region: 13-336
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-50
Family FAD-linked reductases, N-terminal domain 0.0057
Further Details:      
 
Domain Number 2 Region: 316-412
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.86e-17
Family L-aminoacid/polyamine oxidase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46397310|ref|NP_997011.1|
Sequence length 486
Comment polyamine oxidase isoform 4 [Homo sapiens]
Sequence
MESTGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERCF
GGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGA
SVSLQLVAEMATLFYGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLK
LAVLNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMAALPEDT
VVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHHVIVTVPLGFLREHLDTFF
DPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDAAPELQDAW
FRKLIGFVVLPAFASVHVLCGFIAGLESEFMETLSDEEVLLCLTQVLRRVTAPDPVCGGS
HTSHVLLHDARGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL
TDFSLA
Download sequence
Identical sequences NP_997011.1.87134 NP_997011.1.92137 ENSP00000349847 gi|46397310|ref|NP_997011.1| ENSP00000349847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]