SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|47106067|ref|NP_998766.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47106067|ref|NP_998766.1|
Domain Number 1 Region: 180-225,265-324
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.84e-30
Family Supernatant protein factor (SPF), C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|47106067|ref|NP_998766.1|
Sequence length 325
Comment protein TMED8 [Homo sapiens]
Sequence
MSDLQAAEGPGSWSPTARPGSAGGVGDCQGVEGSQAAASENEDLENKDTSLLASATDPEP
CSSPHRPQMVSPVSKDATEDLRKATGPLEAQALVKQDLLPADQAQVLNEMAKYQVPQRSG
DIVMIQSEHTGAIDVLSADLESADLLGDHRKVSPPLMAPPCIWTFAKVKEFKSKLGKEKN
SRLVVKRGEVVTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDWTPVTSTDITVQVSDSSD
DEDEEEEEEEEIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI
YLLKFDNSYSLLRNKTLYFHIYYTS
Download sequence
Identical sequences Q6PL24
9606.ENSP00000216468 ENSP00000216468 ENSP00000216468 NP_998766.1.87134 NP_998766.1.92137 ENSP00000216468 gi|47106067|ref|NP_998766.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]