SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|47519929|ref|NP_387504.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47519929|ref|NP_387504.2|
Domain Number 1 Region: 38-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.16e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 153-339
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.88e-37
Family Laminin G-like module 0.0064
Further Details:      
 
Domain Number 3 Region: 338-518
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.81e-35
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 4 Region: 783-959
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.37e-35
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 969-1173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.33e-30
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 6 Region: 577-635
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000000314
Family Fibrinogen C-terminal domain-like 0.0033
Further Details:      
 
Domain Number 7 Region: 549-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000926
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|47519929|ref|NP_387504.2|
Sequence length 1288
Comment contactin-associated protein-like 3 precursor [Homo sapiens]
Sequence
MASVAWAVLKVLLLLPTQTWSPVGAGNPPDCDAPLASALPRSSFSSSSELSSSHGPGFSR
LNRRDGAGGWTPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSDWVTSYLLMFSDGGRNW
KQYRREESIWGFPGNTNADSVVHYRLQPPFEARFLRFLPLAWNPRGRIGMRIEVYGCAYK
SEVVYFDGQSALLYRLDKKPLKPIRDVISLKFKAMQSNGILLHREGQHGNHITLELIKGK
LVFFLNSGNAKLPSTIAPVTLTLGSLLDDQHWHSVLIELLDTQVNFTVDKHTHHFQAKGD
SSYLDLNFEISFGGIPTPGRSRAFRRKSFHGCLENLYYNGVDVTELAKKHKPQILMMGNV
SFSCPQPQTVPVTFLSSRSYLALPGNSGEDKVSVTFQFRTWNRAGHLLFGELRRGSGSFV
LFLKDGKLKLSLFQPGQSPRNVTAGAGLNDGQWHSVSFSAKWSHMNVVVDDDTAVQPLVA
VLIDSGDTYYFGGCLDNSSGSGCKSPLGGFQGCLRLITIGDKAVDPILVQQGALGSFRDL
QIDSCGITDRCLPSYCEHGGECSQSWDTFSCDCLGTGYTGETCHSSLYEQSCEAHKHRGN
PSGLYYIDADGSGPLGPFLVYCNMTADAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYA
AGAGQLRSAVNLAERCEQRLALRCGTARRPDSRDGTPLSWWVGRTNETHTSWGGSLPDAQ
KCTCGLEGNCIDSQYYCNCDAGRNEWTSDTIVLSQKEHLPVTQIVMTDAGRPHSEAAYTL
GPLLCRGDQSFWNSASFNTETSYLHFPAFHGELTADVCFFFKTTVSSGVFMENLGITDFI
RIELRAPTEVTFSFDVGNGPCEVTVQSPTPFNDNQWHHVRAERNVKGASLQVDQLPQKMQ
PAPADGHVRLQLNSQLFIGGTATRQRGFLGCIRSLQLNGVALDLEERATVTPGVEPGCAG
HCSTYGHLCRNGGRCREKRRGVTCDCAFSAYDGPFCSNEISAYFATGSSMTYHFQEHYTL
SENSSSLVSSLHRDVTLTREMITLSFRTTRTPSLLLYVSSFYEEYLSVILANNGSLQIRY
KLDRHQNPDAFTFDFKNMADGQLHQVKINREEAVVMVEVNQSTKKQVILSSGTEFNAVKS
LILGKVLEAAGADPDTRRAATSGFTGCLSAVRFGRAAPLKAALRPSGPSRVTVRGHVAPM
ARCAAGAASGSPARELAPRLAGGAGRSGPADEGEPLVNADRRDSAVIGGVIAVVIFILLC
ITAIAIRIYQQRKLRKENESKVSKKEEC
Download sequence
Identical sequences Q9BZ76
9606.ENSP00000297668 NP_387504.2.87134 NP_387504.2.92137 ENSP00000297668 ENSP00000297668 gi|47519929|ref|NP_387504.2| ENSP00000297668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]