SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4757890|ref|NP_004328.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4757890|ref|NP_004328.1|
Domain Number 1 Region: 16-37,124-201,251-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000561
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 
Weak hits

Sequence:  gi|4757890|ref|NP_004328.1|
Domain Number - Region: 12-52,248-317,371-482
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00363
Family FAD/NAD-linked reductases, N-terminal and central domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|4757890|ref|NP_004328.1|
Sequence length 505
Comment oxidative stress-induced growth inhibitor 2 isoform 2 [Homo sapiens]
Sequence
MPLVEETSLLEDSSVTFPVVIIGNGPSGICLSYMLSGYRPYLSSEAIHPNTILNSKLEEA
RHLSIVDQDLEYLSEGLEGRSSNPVAVLFDTLLHPDADFGYDYPSVLHWKLEQHHYIPHV
VLGKGPPGGAWHNMEGSMLTISFGSWMELPGLKFKDWVSSKRRSLKGDRVMPEEIARYYK
HYVKVMGLQKNFRENTYITSVSRLYRDQDDDDIQDRDISTKHLQIEKSNFIKRNWEIRGY
QRIADGSHVPFCLFAENVALATGTLDSPAHLEIEGEDFPFVFHSMPEFGAAINKGKLRGK
VDPVLIVGSGLTAADAVLCAYNSNIPVIHVFRRRVTDPSLIFKQLPKKLYPEYHKVYHMM
CTQSYSVDSNLLSDYTSFPEHRVLSFKSDMKCVLQSVSGLKKIFKLSAAVVLIGSHPNLS
FLKDQGCYLGHKSSQPITCKGNPVEIDTYTYECIKEANLFALGPLVGDNFVRFLKGGALG
VTRCLATRQKKKHLFVERGGGDGIA
Download sequence
Identical sequences A0A024R9D5 Q9Y236
ENSP00000297438 gi|4757890|ref|NP_004328.1| ENSP00000297438 NP_004328.1.87134 NP_004328.1.92137 XP_011515589.1.92137 NYSGRC-4757890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]