SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4758606|ref|NP_004508.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4758606|ref|NP_004508.1|
Domain Number 1 Region: 177-444
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.91e-47
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 7-141
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-36
Family Ankyrin repeat 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4758606|ref|NP_004508.1|
Sequence length 452
Comment integrin-linked protein kinase [Homo sapiens]
Sequence
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Download sequence
Identical sequences A0A0D9QWF6 A0A1D5R971 A0A2K5BWC2 A0A2K5IZW9 A0A2K5RE57 A0A2K5YLV0 A0A2K6BHG9 A0A2K6LAY7 A0A2K6NUG9 A0A2K6TPG2 F7DKL4 G1S6P2 G3QDQ9 G7PQV1 H2NE91 H2Q325 Q13418 V9HWF0
ENSNLEP00000021181 ENSGGOP00000000385 ENSNLEP00000021181 ENSP00000299421 gi|4758606|ref|NP_004508.1| gi|62420873|ref|NP_001014794.1| gi|62420875|ref|NP_001014795.1| 9544.ENSMMUP00000010171 9598.ENSPTRP00000005773 9600.ENSPPYP00000004056 9606.ENSP00000299421 NP_001014794.1.87134 NP_001014794.1.92137 NP_001014795.1.87134 NP_001014795.1.92137 NP_001182642.1.72884 NP_004508.1.87134 NP_004508.1.92137 XP_001164277.2.37143 XP_003254909.1.23891 XP_003254910.1.23891 XP_003312944.1.37143 XP_003819130.1.60992 XP_003819131.1.60992 XP_004050647.1.27298 XP_004050648.1.27298 XP_005252961.1.92137 XP_005578833.1.63531 XP_008006642.1.81039 XP_008006643.1.81039 XP_008970711.1.60992 XP_009005843.1.60252 XP_010336168.1.74449 XP_010336202.1.74449 XP_010381853.1.97406 XP_010381854.1.97406 XP_010381855.1.97406 XP_010381856.1.97406 XP_011518367.1.92137 XP_011751308.1.29376 XP_011751309.1.29376 XP_011809721.1.43180 XP_011809722.1.43180 XP_011827876.1.47321 XP_012312169.1.9421 XP_012312170.1.9421 XP_014970233.1.72884 XP_014970234.1.72884 XP_017362695.1.71028 XP_017362698.1.71028 XP_017749117.1.44346 XP_017749118.1.44346 XP_017749119.1.44346 XP_017749120.1.44346 ENSP00000299421 ENSP00000379975 ENSP00000403487 ENSP00000299421 ENSP00000379975 ENSP00000403487 ENSMMUP00000010171 ENSPTRP00000005773 ENSCJAP00000044247 HR2925 ENSGGOP00000000385 ENSPTRP00000005773 ENSPPYP00000004056 ENSPPYP00000004056 ENSPPYP00000023691 ENSMMUP00000010171 ENSCJAP00000025741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]