SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4759274|ref|NP_004777.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4759274|ref|NP_004777.1|
Domain Number 1 Region: 114-268
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.74e-48
Family Hypothetical protein AT3g04780/F7O18 27 0.0000555
Further Details:      
 
Domain Number 2 Region: 4-108
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.17e-22
Family Thioltransferase 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4759274|ref|NP_004777.1|
Sequence length 289
Comment thioredoxin-like protein 1 [Homo sapiens]
Sequence
MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVD
VHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIP
KGYMDLMPFINKAGCECLNESDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSM
KFQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQN
VNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH
Download sequence
Identical sequences A0A2K5EAE9 A0A2K6TTY6 F6S6V9 G1R991 G3S1H4 H2NWE5 H2QEK5 O43396 V9HW51
gi|4759274|ref|NP_004777.1| ENSCJAP00000007322 ENSPTRP00000017065 NP_004777.1.87134 NP_004777.1.92137 XP_002757317.1.60252 XP_002828285.1.23681 XP_003264314.1.23891 XP_003827293.1.60992 XP_003926097.1.74449 XP_004059509.1.27298 XP_004405883.1.74151 XP_006737373.1.47382 XP_008690673.1.72690 XP_012301868.1.9421 XP_016881582.1.92137 XP_512145.2.37143 ENSNLEP00000009780 ENSPPYP00000010308 ENSP00000217515 ENSP00000464918 ENSNLEP00000009780 ENSP00000217515 ENSP00000464918 ENSCJAP00000007322 ENSGGOP00000021920 9598.ENSPTRP00000017065 9600.ENSPPYP00000010308 9606.ENSP00000217515 ENSPTRP00000017065 ENSP00000217515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]