SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|47825361|ref|NP_001001414.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47825361|ref|NP_001001414.1|
Domain Number 1 Region: 92-272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-52
Family F-box associated region, FBA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|47825361|ref|NP_001001414.1|
Sequence length 275
Comment non-specific cytotoxic cell receptor protein 1 homolog [Homo sapiens]
Sequence
MEEVREGHALGGGMEADGPASLQELPPSPRSPSPPPSPPPLPSPPSLPSPAAPEAPELPE
PAQPSEAHARQLLLEEWGPLSGGLELPQRLTWKLLLLRRPLYRNLLRSPNPEGINIYEPA
PPTGPTQRPLETLGNFRGWYIRTEKLQQNQSWTVKQQCVDLLAEGLWEELLDDEQPAITV
MDWFEDSRLDACVYELHVWLLAADRRTVIAQHHVAPRTSGRGPPGRWVQVSHVFRHYGPG
VRFIHFLHKAKNRMEPGGLRRTRVTDSSVSVQLRE
Download sequence
Identical sequences Q6ZVX7
ENSP00000342137 ENSP00000342137 9606.ENSP00000342137 gi|47825361|ref|NP_001001414.1| NP_001001414.1.87134 NP_001001414.1.92137 ENSP00000342137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]