SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|47933348|ref|NP_001001483.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|47933348|ref|NP_001001483.1|
Domain Number 1 Region: 1-140
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-31
Family Ankyrin repeat 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|47933348|ref|NP_001001483.1|
Sequence length 492
Comment palmitoyltransferase ZDHHC13 isoform 2 [Homo sapiens]
Sequence
MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDVNGQTPLMLSA
HKVIGPEPTGFLLKFNPSLNVVDKIHQNTPLHWAVAAGNVNAVDKLLEAGSSLDIQNVKG
ETPLDMALQNKNQLIIHMLKTEAKMRANQKFRLWRWLQKCELFLLLMLSVITMWAIGYIL
DFNSDSWLLKGCLLVTLFFLTSLFPRFLVGYKNLVYLPTAFLLSSVFWIFMTWFILFFPD
LAGAPFYFSFIFSIVAFLYFFYKTWATDPGFTKASEEEKKVNIITLAETGSLDFRTFCTS
CLIRKPLRSLHCHVCNCCVARYDQHCLWTGRCIGFGNHHYYIFFLFFLSMVCGWIIYGSF
IYLSSHCATTFKEDGLWTYLNQIVACSPWVLYILMLATFHFSWSTFLLLNQLFQIAFLGL
TSHERISLQKQSKHMKQTLSLRKTPYNLGFMQNLADFFQCGCFGLVKPCVVDWTSQYTMV
FHPAREKVLRSV
Download sequence
Identical sequences NP_001001483.1.87134 NP_001001483.1.92137 XP_005253053.1.92137 XP_011518497.1.92137 gi|47933348|ref|NP_001001483.1| ENSP00000382288 ENSP00000382288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]