SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4885049|ref|NP_005150.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4885049|ref|NP_005150.1|
Domain Number 1 Region: 149-377
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.19e-99
Family Actin/HSP70 0.000000001
Further Details:      
 
Domain Number 2 Region: 6-155
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 9.07e-66
Family Actin/HSP70 0.000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|4885049|ref|NP_005150.1|
Sequence length 377
Comment actin, alpha cardiac muscle 1 proprotein [Homo sapiens]
Sequence
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
Download sequence
Identical sequences A0A060VMK5 A0A091EC68 A0A091F354 A0A091H3K2 A0A091P9L1 A0A091VD29 A0A093GAQ1 A0A099YZ88 A0A0D9R480 A0A0Q3MP44 A0A151MW75 A0A1A6HME8 A0A1S2ZMR8 A0A1U7TVQ3 A0A1U8C9T4 A0A212CUK9 A0A218V7B1 A0A226NEQ9 A0A226PWW0 A0A2K5E7U8 A0A2K5J9P8 A0A2K5LWV5 A0A2K5QB53 A0A2K5Z9E9 A0A2K6BAI3 A0A2K6EUN7 A0A2K6LR43 A0A2K6QJH6 A0A2K6U7B3 B6VNT8 D2H7R6 F2Z4N7 F6R1X9 F7F210 F7GL73 F7H022 G1NIB8 G1P6I6 G1RK14 G1STB6 G3H5Q0 G3R7H3 G3TQN7 G3WWL9 G7PAP7 H0VGS3 H0XKB8 H0ZNH2 H2NMR4 H2Q943 H3AUT1 I3N437 I6ZP58 M3WK07 M3Y9U3 P68032 P68033 P68034 P68035 Q3ZC07 Q497E4 Q52QH9 Q6P640 U3JT25 W5ZMF8
ENSCJAP00000039173 ENSOCUP00000006542 ENSP00000290378 ENSGGOP00000011310 ENSGGOP00000019457 10090.ENSMUSP00000087736 10116.ENSRNOP00000011773 10141.ENSCPOP00000001880 13616.ENSMODP00000011118 28377.ENSACAP00000001039 59729.ENSTGUP00000012148 8364.ENSXETP00000028240 9031.ENSGALP00000015988 9544.ENSMMUP00000009222 9598.ENSPTRP00000011770 9600.ENSPPYP00000007159 9606.ENSP00000290378 9615.ENSCAFP00000017976 9796.ENSECAP00000010864 9823.ENSSSCP00000005172 9986.ENSOCUP00000006542 ENSCPOP00000001880 ENSAMEP00000005482 ENSMMUP00000009222 ENSPANP00000016280 ENSGALP00000015988 ENSLACP00000013402 ENSPPYP00000007159 ENSMODP00000011118 ENSRNOP00000011773 ENSMGAP00000012999 ENSGGOP00000011310 ENSFALP00000005929 ENSOCUP00000006542 ENSAMEP00000005482 ENSCPOP00000001880 ENSTGUP00000012148 ENSMGAP00000012999 ENSMPUP00000008100 ENSRNOP00000011773 ENSMUSP00000087736 ENSMLUP00000005681 ENSSHAP00000019824 ENSLACP00000013402 ENSPTRP00000011770 ENSECAP00000010864 ENSPTRP00000011770 ENSP00000290378 gi|4885049|ref|NP_005150.1| ENSCAFP00000017976 ENSMUSP00000087736 ENSMODP00000011118 ENSMPUP00000008100 ENSBTAP00000007504 ENSOGAP00000016558 ENSNLEP00000013571 ENSSTOP00000019133 ENSLAFP00000017882 ENSSTOP00000019133 ENSP00000290378 ENSCAFP00000017976 ENSDNOP00000012068 ENSOGAP00000016558 gi|38382923|gb|AAH62494| gi|45360837|ref|NP_989094| gi|82202420|sp|Q6P640| ENSMMUP00000009222 ENSCJAP00000039173 ENSSSCP00000005172 ENSGALP00000015988 ENSACAP00000001039 NP_001029757.1.59421 NP_001029757.1.76553 NP_001072949.1.86415 NP_001163988.1.46622 NP_005150.1.87134 NP_005150.1.92137 NP_033738.1.92730 NP_062056.1.100692 NP_062056.1.4139 NP_989094.1.99540 XP_001370562.1.35504 XP_001503700.1.31192 XP_002200536.1.42559 XP_002718044.1.1745 XP_002753617.1.60252 XP_002825309.2.23681 XP_003214525.3.98722 XP_003272841.1.23891 XP_003418690.1.64505 XP_003475712.1.53824 XP_003499581.1.69978 XP_003756019.1.9362 XP_003812182.1.60992 XP_003987346.1.62641 XP_004055981.1.27298 XP_004088324.1.23891 XP_004274077.1.21590 XP_004380657.1.4749 XP_004409085.1.74151 XP_004421440.1.5094 XP_004455418.1.11602 XP_004578253.1.84141 XP_004609607.1.94378 XP_004643176.1.9945 XP_004668258.1.11716 XP_004687999.1.23501 XP_004712740.1.18182 XP_004751104.1.14098 XP_004861564.1.39548 XP_005047317.1.66865 XP_005149344.1.78019 XP_005234669.1.75256 XP_005300031.1.60341 XP_005300032.1.60341 XP_005337186.1.77405 XP_005364270.1.66349 XP_005381236.1.28644 XP_005417559.1.5688 XP_005479935.1.73095 XP_005520380.1.90289 XP_005559154.1.63531 XP_005968223.1.78601 XP_006004123.1.90931 XP_006004124.1.90931 XP_006044050.1.26621 XP_006087552.1.53796 XP_006201681.1.17985 XP_006274042.1.47583 XP_006632484.1.81211 XP_006730362.1.47382 XP_006831863.1.41390 XP_006983915.1.50099 XP_007116833.1.24612 XP_007434178.1.37977 XP_007521753.1.11023 XP_007615413.1.28591 XP_007615414.1.28591 XP_007638487.1.69978 XP_007938667.1.48129 XP_008015319.1.81039 XP_008015320.1.81039 XP_008064079.1.4292 XP_008141189.1.99482 XP_008515544.1.77740 XP_008637780.1.15636 XP_008839383.1.79516 XP_009100194.1.15306 XP_009466971.1.38621 XP_009565558.1.62272 XP_009708793.1.71050 XP_009910000.1.92783 XP_009959020.1.99599 XP_010006008.1.85724 XP_010209372.1.20684 XP_010344561.1.74449 XP_010365837.1.97406 XP_010572531.1.12557 XP_010572532.1.12557 XP_010622925.1.5607 XP_010709885.1.16129 XP_010842487.1.44457 XP_010876993.1.71217 XP_010880586.1.71217 XP_011353171.1.92234 XP_011580668.1.59079 XP_011758599.1.29376 XP_011788065.1.43180 XP_011788066.1.43180 XP_011848080.1.47321 XP_011890080.1.92194 XP_012013662.1.54773 XP_012320726.1.9421 XP_012504922.1.63892 XP_012621797.1.48125 XP_012661808.1.62490 XP_012975185.1.91757 XP_013795910.1.3284 XP_013822406.2.57651 XP_014203242.1.60992 XP_014348802.1.90931 XP_014702795.1.49734 XP_014702796.1.49734 XP_014746980.1.99236 XP_014997295.1.72884 XP_015280026.1.55130 XP_015280027.1.55130 XP_015336337.1.40921 XP_015399997.1.5354 XP_015487537.1.82291 XP_015684708.1.16292 XP_015995095.1.101085 XP_016075926.1.3490 XP_017395017.1.71028 XP_017515153.1.32401 XP_017682862.1.3805 XP_017749776.1.44346 XP_017937788.1.51550 XP_018428255.1.44173 XP_018428256.1.44173 XP_019149628.1.2935 XP_019298190.1.44245 XP_019374484.1.87953 XP_019407850.1.79039 XP_019504751.1.44202 XP_019581110.1.88060 XP_019653684.1.58354 XP_019824031.1.53367 XP_020343427.1.87700 XP_020645056.1.8467 XP_020769969.1.74333 XP_020850605.1.61212 XP_020850676.1.61212 XP_021047734.1.100879 XP_021047735.1.100879 XP_021256728.1.32913 XP_021256729.1.32913 XP_021256730.1.32913 XP_021256731.1.32913 XP_021394989.1.53032 XP_021429777.1.32639 XP_021505150.1.76796 XP_021551009.1.83697 XP_510285.1.37143 XP_535424.1.84170 ENSTGUP00000012148 ENSNLEP00000013571 ENSPPYP00000007159 ENSFCAP00000013045 ENSMUSP00000087736 ENSLAFP00000017882 ENSECAP00000010864 ENSMLUP00000005681 ENSSSCP00000005172 ENSBTAP00000007504 ENSSHAP00000019824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]