SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4885221|ref|NP_005230.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4885221|ref|NP_005230.1|
Domain Number 1 Region: 347-461
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.4e-48
Family ets domain 0.00000101
Further Details:      
 
Domain Number 2 Region: 66-167
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.73e-34
Family Pointed domain 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4885221|ref|NP_005230.1|
Sequence length 469
Comment protein C-ets-2 [Homo sapiens]
Sequence
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSIS
HDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATN
EFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEE
NSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFP
KSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG
LRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED
Download sequence
Identical sequences H2R1W7 P15036
ENSP00000353344 ENSP00000354194 ENSPTRP00000043001 ENSPTRP00000043001 ENSP00000353344 ENSP00000354194 NP_005230.1.87134 NP_005230.1.92137 XP_005260992.1.92137 XP_008975883.1.60992 XP_016883779.1.92137 9598.ENSPTRP00000043001 9606.ENSP00000353344 ENSP00000353344 gi|4885221|ref|NP_005230.1| HR5529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]