SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4885285|ref|NP_005467.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4885285|ref|NP_005467.1|
Domain Number 1 Region: 9-387
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 5.1e-79
Family UDP-N-acetylglucosamine 2-epimerase 0.0013
Further Details:      
 
Domain Number 2 Region: 409-717
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.23e-57
Family ROK 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4885285|ref|NP_005467.1|
Sequence length 722
Comment bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase isoform 2 [Homo sapiens]
Sequence
MEKNGNNRKLRVCVATCNRADYSKLAPIMFGIKTEPEFFELDVVVLGSHLIDDYGNTYRM
IEQDDFDINTRLHTIVRGEDEAAMVESVGLALVKLPDVLNRLKPDIMIVHGDRFDALALA
TSAALMNIRILHIEGGEVSGTIDDSIRHAITKLAHYHVCCTRSAEQHLISMCEDHDRILL
AGCPSYDKLLSAKNKDYMSIIRMWLGDDVKSKDYIVALQHPVTTDIKHSIKMFELTLDAL
ISFNKRTLVLFPNIDAGSKEMVRVMRKKGIEHHPNFRAVKHVPFDQFIQLVAHAGCMIGN
SSCGVREVGAFGTPVINLGTRQIGRETGENVLHVRDADTQDKILQALHLQFGKQYPCSKI
YGDGNAVPRILKFLKSIDLQEPLQKKFCFPPVKENISQDIDHILETLSALAVDLGGTNLR
VAIVSMKGEIVKKYTQFNPKTYEERINLILQMCVEAAAEAVKLNCRILGVGISTGGRVNP
REGIVLHSTKLIQEWNSVDLRTPLSDTLHLPVWVDNDGNCAALAERKFGQGKGLENFVTL
ITGTGIGGGIIHQHELIHGSSFCAAELGHLVVSLDGPDCSCGSHGCIEAYASGMALQREA
KKLHDEDLLLVEGMSVPKDEAVGALHLIQAAKLGNAKAQSILRTAGTALGLGVVNILHTM
NPSLVILSGVLASHYIHIVKDVIRQQALSSVQDVDVVVSDLVDPALLGAASMVLDYTTRR
IY
Download sequence
Identical sequences A0A2I3RDN5 A0A2K5S4I9 A0A2K6FTC9 A0A2K6TMX9 H2PRQ6 Q9Y223
gi|4885285|ref|NP_005467.1| ENSPPYP00000021367 NP_005467.1.87134 NP_005467.1.92137 XP_003829905.1.60992 XP_003943825.1.74449 XP_009242544.1.23681 XP_012318788.1.9421 XP_012511997.1.63892 XP_012625412.1.48125 XP_016869656.1.92137 XP_017398643.1.71028 XP_520577.2.37143 ENSP00000367134 ENSP00000439155 ENSP00000367134 ENSP00000439155 ENSPPYP00000021367 9598.ENSPTRP00000035798 9600.ENSPPYP00000021367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]