SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|4885617|ref|NP_005411.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|4885617|ref|NP_005411.1|
Domain Number 1 Region: 14-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.63e-132
Family PAPS sulfotransferase 0.00000000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|4885617|ref|NP_005411.1|
Sequence length 294
Comment estrogen sulfotransferase [Homo sapiens]
Sequence
MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMI
YKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEK
DCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWE
KGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYT
TLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI
Download sequence
Identical sequences P49888 Q53X91
1g3mA cath|current|1g3mA00/3-292 cath|current|1g3mB00/3-292 9606.ENSP00000226444 ENSP00000226444 ENSP00000226444 gi|4885617|ref|NP_005411.1| 1g3m_A 1g3m_B ENSP00000420891 NP_005411.1.87134 NP_005411.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]