SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49574510|ref|NP_057097.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49574510|ref|NP_057097.2|
Domain Number 1 Region: 122-302
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-42
Family CBM11 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|49574510|ref|NP_057097.2|
Sequence length 327
Comment complex I intermediate-associated protein 30, mitochondrial precursor [Homo sapiens]
Sequence
MALVHKLLRGTYFLRKFSKPTSALYPFLGIRFAEYSSSLQKPVASPGKASSQRKTEGDLQ
GDHQKEVALDITSSEEKPDVSFDKAIRDEAIYHFRLLKDEIVDHWRGPEGHPLHEVLLEQ
AKVVWQFRGKEDLDKWTVTSDKTIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESTRS
GYCAMISRIPRGAFERKMSYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYF
MFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKISSIGFTLADKVDGPFFLEIDF
IGVFTDPAHTEEFAYENSPELNPRLFK
Download sequence
Identical sequences A0A024R9L0 Q9Y375
HR6599 NYSGRC-49574510 ENSP00000260361 gi|49574510|ref|NP_057097.2| 9606.ENSP00000260361 ENSP00000260361 NP_057097.2.87134 NP_057097.2.92137 XP_006720618.1.92137 XP_011519960.1.92137 ENSP00000260361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]