SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49574514|ref|NP_000891.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49574514|ref|NP_000891.2|
Domain Number 1 Region: 66-98
Classification Level Classification E-value
Superfamily GLA-domain 0.000000000824
Family GLA-domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|49574514|ref|NP_000891.2|
Sequence length 103
Comment matrix Gla protein isoform 2 precursor [Homo sapiens]
Sequence
MKSLILLAILAALAVVTLCYESHESMESYELNPFINRRNANTFISPQQRWRAKVQERIRE
RSKPVHELNREACDDYRLCERYAMVYGYNAAYNRYFRKRRGTK
Download sequence
Identical sequences A0A024RAX0 P08493
9606.ENSP00000228938 gi|49574514|ref|NP_000891.2| NP_000891.2.87134 NP_000891.2.92137 ENSP00000445907 ENSP00000445907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]