SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5031569|ref|NP_005727.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5031569|ref|NP_005727.1|
Domain Number 1 Region: 153-373
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.9e-120
Family Actin/HSP70 0.035
Further Details:      
 
Domain Number 2 Region: 10-151
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 8.25e-79
Family Actin/HSP70 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5031569|ref|NP_005727.1|
Sequence length 376
Comment alpha-centractin [Homo sapiens]
Sequence
MESYDVIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDIFIGP
KAEEHRGLLSIRYPMEHGIVKDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPRKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSI
MRIDIAGRDVSRFLRLYLRKEGYDFHSSSEFEIVKAIKERACYLSINPQKDETLETEKAQ
YYLPDGSTIEIGPSRFRAPELLFRPDLIGEESEGIHEVLVFAIQKSDMDLRRTLFSNIVL
SGGSTLFKGFGDRLLSEVKKLAPKDVKIRISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDGARSIHRKTF
Download sequence
Identical sequences A0A091DPY8 A0A096P6F2 A0A0D9QZD8 A0A1A6GV67 A0A1S3F9Q5 A0A2K5K827 A0A2K5MLW4 A0A2K5PYK2 A0A2K5ZZV9 A0A2K6BCH4 A0A2K6FVT3 A0A2K6LIG1 A0A2K6QRM1 A0A2K6SER5 F2Z4F0 F2Z5G5 F6QFY6 F6QXY2 F7HIJ6 G1MHH5 G1P6V4 G1RYT8 G1SPM5 G3HXW9 G3QJD6 G3SVH1 G5CAH6 G7PDV1 H0VSV0 H0WQS1 H2NBF7 I3MMX5 K7D8B6 L8J3G7 M3VWA6 M3YZK3 P61162 P61163 P61164 P85515 Q4R6J9 S7Q2T4 S9X530 W5NSM1
ENSSSCP00000011276 ENSP00000358921 ENSOGAP00000004325 ENSSARP00000005714 ENSPANP00000020927 ENSAMEP00000018810 ENSSTOP00000012932 ENSCPOP00000009971 ENSMUSP00000039844 gi|5031569|ref|NP_005727.1| ENSAMEP00000018810 NP_001003164.1.84170 NP_001099834.1.100692 NP_001099834.1.4139 NP_001180177.1.59421 NP_001180177.1.76553 NP_001244704.1.72884 NP_005727.1.87134 NP_005727.1.92137 NP_058556.1.92730 XP_001928912.1.46622 XP_002718680.1.1745 XP_002756603.1.60252 XP_002821149.1.23681 XP_002913933.1.58354 XP_003255449.1.23891 XP_003363477.1.31192 XP_003409198.1.64505 XP_003475023.1.53824 XP_003508095.1.69978 XP_003787265.1.62490 XP_003825570.1.60992 XP_003922299.1.74449 XP_003994413.1.62641 XP_004020196.1.66739 XP_004050069.1.27298 XP_004268565.1.21590 XP_004370140.1.4749 XP_004402036.1.74151 XP_004428066.1.5094 XP_004478915.1.11602 XP_004579959.1.84141 XP_004616372.1.94378 XP_004631538.1.9945 XP_004659454.1.11716 XP_004680540.1.23501 XP_004749445.1.14098 XP_004866502.1.39548 XP_005333676.1.77405 XP_005352466.1.66349 XP_005403892.1.28644 XP_005698431.1.57651 XP_005878309.1.60319 XP_005888113.1.15283 XP_005980801.1.78601 XP_006064972.1.26621 XP_006095957.1.53796 XP_006183033.1.101512 XP_006210524.1.17985 XP_006731127.1.47382 XP_006756537.1.95426 XP_006831357.1.41390 XP_006880040.1.29581 XP_006920968.1.64745 XP_007080291.1.5354 XP_007126950.1.24612 XP_007187311.1.59432 XP_007187312.1.59432 XP_007470468.1.90284 XP_007637883.1.28591 XP_007962166.1.81039 XP_008142466.1.99482 XP_008529180.1.77740 XP_008708682.1.72690 XP_008843877.1.79516 XP_010354474.1.97406 XP_010624734.1.5607 XP_010857742.1.44457 XP_010969286.1.22495 XP_010972799.1.51371 XP_011384129.1.92234 XP_011733820.1.29376 XP_011812773.1.43180 XP_011832862.1.47321 XP_011907047.1.92194 XP_011974984.1.54773 XP_012517147.1.63892 XP_012625440.1.48125 XP_012873271.1.60039 XP_014707445.1.49734 XP_014918552.1.86478 XP_015350205.1.40921 XP_016010016.1.101085 XP_016075504.1.3490 XP_017386640.1.71028 XP_017707180.1.44346 XP_019314811.1.44245 XP_019491949.1.44202 XP_019580569.1.88060 XP_019795456.1.83887 XP_019808414.1.53367 XP_020026786.1.5219 XP_020753542.1.74333 XP_021047027.1.100879 XP_021506034.1.76796 XP_021555161.1.83697 ENSFCAP00000001159 ENSP00000358921 ENSNLEP00000018415 ENSCAFP00000014989 ENSECAP00000022084 ENSDNOP00000013777 ENSMLUP00000005811 ENSMPUP00000016763 ENSNLEP00000018415 ENSLAFP00000004237 ENSOCUP00000005004 ENSMUSP00000039844 ENSPPYP00000003029 ENSCJAP00000004867 6f1t_A 6f1t_B 6f1t_C 6f1t_D 6f1t_E 6f1t_F 6f1t_G 6f1t_I 6f1u_B 6f1u_D 6f1u_F 6f38_A 6f38_B 6f38_C 6f38_D 6f38_E 6f38_F 6f38_G 6f38_I 6f3a_A 6f3a_B 6f3a_C 6f3a_D 6f3a_E 6f3a_F 6f3a_G 6f3a_I ENSMPUP00000016763 ENSMMUP00000015668 10090.ENSMUSP00000039844 10116.ENSRNOP00000026792 10141.ENSCPOP00000009971 9544.ENSMMUP00000015668 9598.ENSPTRP00000005101 9600.ENSPPYP00000003029 9606.ENSP00000358921 9615.ENSCAFP00000014989 9796.ENSECAP00000022084 9823.ENSSSCP00000011276 9913.ENSBTAP00000028053 9986.ENSOCUP00000005004 ENSCAFP00000014989 ENSBTAP00000028053 ENSOPRP00000006067 ENSBTAP00000028053 ENSPTRP00000005101 ENSPTRP00000005101 ENSSSCP00000011276 ENSMMUP00000015668 ENSRNOP00000026792 ENSCJAP00000033297 ENSPPYP00000003029 ENSOGAP00000004325 ENSMUSP00000039844 ENSOARP00000001161 ENSGGOP00000002528 HGL_H00000358921 ENSOCUP00000005004 ENSGGOP00000002528 ENSMLUP00000005811 ENSSTOP00000012932 ENSRNOP00000026792 ENSECAP00000022084 ENSSARP00000005714 ENSP00000358921 ENSCPOP00000009971 ENSOPRP00000006067 ENSLAFP00000004237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]