SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5031571|ref|NP_005713.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5031571|ref|NP_005713.1|
Domain Number 1 Region: 153-386
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.11e-117
Family Actin/HSP70 0.00000205
Further Details:      
 
Domain Number 2 Region: 7-150
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.19e-72
Family Actin/HSP70 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|5031571|ref|NP_005713.1|
Sequence length 394
Comment actin-related protein 2 isoform b [Homo sapiens]
Sequence
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE
ASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNR
EKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTR
RLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLALETTVL
VESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRSEFYKH
IVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAV
LADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
Download sequence
Identical sequences A0A091CU81 A0A096P076 A0A0P6JTI1 A0A1S3ASB9 A0A1S3FN53 A0A1U7TT93 A0A250YH51 A0A287DAX6 A0A2K5F7U1 A0A2K5MIX2 A0A2K5R9G1 A0A2K5VKX2 A0A2K5ZJT9 A0A2K6E479 A0A2K6GKQ1 A0A2K6MBQ3 A0A2K6RKL1 A0A2K6TTV1 A7MB62 B5APU3 F6VEE0 F6ZPQ4 F7EI23 G1P499 G1RFX7 G1SMS3 G3T5A2 H0VVN0 H2P611 K7C293 K9J0H8 L5KTB1 M3W369 M3Y473 P61160 P61161 Q5SW83
ENSMLUP00000004772 ENSDNOP00000026742 ENSMPUP00000006124 1k8k_B 1tyq_B 1u2v_B 2p9i_B 2p9l_B 2p9n_B 2p9p_B 2p9s_B 2p9u_B 3dxk_B 3dxm_B 3rse_B 3ukr_B 3uku_B 3ule_B 4jd2_B 4xei_B 4xf2_B 4xf2_U ENSCJAP00000012464 ENSMMUP00000003020 ENSMPUP00000006124 ENSPPYP00000013782 ENSPPYP00000013782 ENSNLEP00000023409 ENSCPOP00000014756 ENSSSCP00000008921 1k8kB ENSOCUP00000004245 ENSP00000260641 ENSLAFP00000008604 ENSSTOP00000011303 ENSSTOP00000011303 ENSMODP00000004115 ENSOCUP00000004245 NP_001095683.1.59421 NP_001095683.1.76553 NP_001127826.1.46622 NP_001253869.1.72884 NP_005713.1.87134 NP_005713.1.92137 NP_666355.1.92730 XP_001494439.2.31192 XP_002757735.1.60252 XP_002917780.1.58354 XP_003262508.1.23891 XP_003413690.1.64505 XP_003830949.1.60992 XP_003984108.1.62641 XP_004280669.1.21590 XP_004397545.1.74151 XP_004435673.1.5094 XP_004471025.1.11602 XP_004660134.1.11716 XP_004691516.1.23501 XP_004710229.1.18182 XP_004742135.1.14098 XP_004850016.1.39548 XP_005002696.1.53824 XP_005322132.1.77405 XP_005366505.1.66349 XP_005385748.1.28644 XP_005575787.1.63531 XP_005963504.1.78601 XP_006053590.1.26621 XP_006083334.1.53796 XP_006168105.1.99106 XP_006201579.1.17985 XP_006778594.1.95426 XP_006863013.1.41390 XP_006881031.1.29581 XP_006909605.1.64745 XP_006974885.1.50099 XP_007075405.1.5354 XP_007124951.1.24612 XP_007189816.1.59432 XP_007464164.1.90284 XP_007476801.1.35504 XP_007539667.1.11023 XP_007632127.1.28591 XP_007968622.1.81039 XP_008061065.1.4292 XP_008145759.1.99482 XP_008252549.1.1745 XP_008584404.1.73410 XP_008850714.1.79516 XP_010331832.1.74449 XP_010354125.1.97406 XP_010608032.1.5607 XP_010978221.1.51371 XP_011380154.1.92234 XP_011711736.1.29376 XP_011840897.1.47321 XP_011895012.1.92194 XP_011981190.1.54773 XP_012332643.1.9421 XP_012494663.1.63892 XP_012620399.1.48125 XP_012877988.1.60039 XP_014692258.1.49734 XP_014949790.1.66739 XP_015335084.1.40921 XP_016015327.1.101085 XP_016079707.1.3490 XP_016804133.1.37143 XP_017377619.1.71028 XP_017507985.1.32401 XP_017745514.1.44346 XP_017910918.1.57651 XP_019293670.1.44245 XP_019491080.1.44202 XP_019573659.1.88060 XP_019798369.1.83887 XP_019825964.1.53367 XP_020017271.1.5219 XP_020141779.1.48125 XP_020841084.1.61212 XP_021066366.1.100879 XP_021482911.1.76796 XP_021554723.1.83697 XP_538516.1.84170 ENSMUSP00000000137 ENSMLUP00000004772 ENSCPOP00000014756 ENSMUSP00000000137 ENSP00000260641 gi|5031571|ref|NP_005713.1| ENSMUSP00000000137 10090.ENSMUSP00000000137 10141.ENSCPOP00000014756 13616.ENSMODP00000004115 9600.ENSPPYP00000013782 9615.ENSCAFP00000004772 9823.ENSSSCP00000008921 9986.ENSOCUP00000004245 ENSSSCP00000008921 ENSLAFP00000008604 ENSMODP00000004115 ENSCJAP00000012467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]