SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5031573|ref|NP_005712.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5031573|ref|NP_005712.1|
Domain Number 1 Region: 164-409
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 5.93e-109
Family Actin/HSP70 0.0000000392
Further Details:      
 
Domain Number 2 Region: 7-152
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.68e-72
Family Actin/HSP70 0.00000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5031573|ref|NP_005712.1|
Sequence length 418
Comment actin-related protein 3 [Homo sapiens]
Sequence
MAGRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDF
FIGDEAIEKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTP
ENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPV
AEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVK
EFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVV
DEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKP
KPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS
Download sequence
Identical sequences A0A024RAI1 A0A091CVZ1 A0A0B8RZS4 A0A1S2ZP18 A0A250YHX0 A0A2I3M5E9 A0A2J8T239 A0A2K5DVF5 A0A2K5K9G8 A0A2K5M7U9 A0A2K5R810 A0A2K5WY73 A0A2K5YMD5 A0A2K6AU69 A0A2K6GDX2 A0A2K6Q2E2 F2Z5D2 F7CQP3 G1M8Z2 G3SCF3 H2QIL4 H9FNE9 I3MHA7 K9IXP5 L5JZ14 M3YH25 P61157 P61158 Q5R8R1
ENSPTRP00000021215 ENSSSCP00000016650 ENSP00000263238 ENSPPYP00000014282 ENSAMEP00000015812 ENSCJAP00000025986 ENSP00000263238 ENSCJAP00000025945 gi|5031573|ref|NP_005712.1| NP_001126071.1.23681 NP_005712.1.87134 NP_005712.1.92137 NP_776651.1.59421 NP_776651.1.76553 XP_002712451.1.1745 XP_002749556.1.60252 XP_003806107.1.60992 XP_004031706.1.27298 XP_004276538.1.21590 XP_004375132.1.4749 XP_004411279.1.74151 XP_004482960.1.11602 XP_004589410.1.84141 XP_004674761.1.23501 XP_004773419.1.14098 XP_005315987.1.77405 XP_005397755.1.28644 XP_005573027.1.63531 XP_006047512.1.26621 XP_006196162.1.17985 XP_006742574.1.47382 XP_006921085.1.64745 XP_007465956.1.90284 XP_007522351.1.11023 XP_007935818.1.48129 XP_010351863.1.97406 XP_010604517.1.5607 XP_010851916.1.44457 XP_010978374.1.51371 XP_011230964.1.58354 XP_011352820.1.92234 XP_011758017.1.29376 XP_011925138.1.92194 XP_012018479.1.54773 XP_012323841.1.9421 XP_012505976.1.63892 XP_012594940.1.48125 XP_014965432.1.72884 XP_016011784.1.101085 XP_016054978.1.3490 XP_017391519.1.71028 XP_017507756.1.32401 XP_017899934.1.57651 XP_017917505.1.57651 XP_019586686.1.88060 XP_019787467.1.83887 XP_019829284.1.53367 XP_020761079.1.74333 XP_021551596.1.83697 ENSPANP00000011611 ENSP00000263238 ENSGGOP00000025781 ENSDNOP00000007852 ENSPTRP00000021215 ENSPPYP00000014282 ENSMPUP00000010632 1k8kA ENSMPUP00000010632 ENSAMEP00000015812 9598.ENSPTRP00000021215 9600.ENSPPYP00000014282 9606.ENSP00000263238 9823.ENSSSCP00000016650 ENSSSCP00000016650 1k8k_A 1tyq_A 1u2v_A 2p9i_A 2p9k_A 2p9l_A 2p9n_A 2p9p_A 2p9s_A 2p9u_A 3dxk_A 3dxm_A 3rse_A 3ukr_A 3uku_A 3ule_A 4jd2_A 4xei_A 4xf2_A 4xf2_T

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]