SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50727002|ref|NP_061915.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50727002|ref|NP_061915.2|
Domain Number 1 Region: 112-142,247-400,466-592,622-646
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.88e-105
Family tRNA pseudouridine synthase TruD 0.001
Further Details:      
 
Weak hits

Sequence:  gi|50727002|ref|NP_061915.2|
Domain Number - Region: 179-234
Classification Level Classification E-value
Superfamily R3H domain 0.0902
Family R3H domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50727002|ref|NP_061915.2|
Sequence length 661
Comment pseudouridylate synthase 7 homolog [Homo sapiens]
Sequence
MEMTEMTGVSLKRGALVVEDNDSGVPVEETKKQKLSECSLTKGQDGLQNDFLSISEDVPR
PPDTVSTGKGGKNSEAQLEDEEEEEEDGLSEECEEEESESFADMMKHGLTEADVGITKFV
SSHQGFSGILKERYSDFVVHEIGKDGRISHLNDLSIPVDEEDPSEDIFTVLTAEEKQRLE
ELQLFKNKETSVAIEVIEDTKEKRTIIHQAIKSLFPGLETKTEDREGKKYIVAYHAAGKK
ALANPRKHSWPKSRGSYCHFVLYKENKDTMDAINVLSKYLRVKPNIFSYMGTKDKRAITV
QEIAVLKITAQRLAHLNKCLMNFKLGNFSYQKNPLKLGELQGNHFTVVLRNITGTDDQVQ
QAMNSLKEIGFINYYGMQRFGTTAVPTYQVGRAILQNSWTEVMDLILKPRSGAEKGYLVK
CREEWAKTKDPTAALRKLPVKRCVEGQLLRGLSKYGMKNIVSAFGIIPRNNRLMYIHSYQ
SYVWNNMVSKRIEDYGLKPVPGDLVLKGATATYIEEDDVNNYSIHDVVMPLPGFDVIYPK
HKIQEAYREMLTADNLDIDNMRHKIRDYSLSGAYRKIIIRPQNVSWEVVAYDDPKIPLFN
TDVDNLEGKTPPVFASEGKYRALKMDFSLPPSTYATMAIREVLKMDTSIKNQTQLNTTWL
R
Download sequence
Identical sequences H2QV72 Q96PZ0
ENSP00000348722 ENSP00000417402 NP_001305093.1.87134 NP_001305093.1.92137 NP_061915.2.87134 NP_061915.2.92137 XP_003811234.1.60992 XP_003811235.1.60992 XP_016801145.1.37143 XP_016801146.1.37143 XP_527856.3.37143 ENSPTRP00000033508 GO.79458 9606.ENSP00000348722 ENSP00000348722 ENSP00000417402 ENSPTRP00000033508 ENSP00000417402 gi|50727002|ref|NP_061915.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]