SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|50897294|ref|NP_001002920.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|50897294|ref|NP_001002920.1|
Domain Number 1 Region: 56-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.79e-44
Family Ankyrin repeat 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|50897294|ref|NP_001002920.1|
Sequence length 452
Comment POTE ankyrin domain family member A isoform 1 [Homo sapiens]
Sequence
MVAEVSPKLAASPMKKPFGFRGKMGKWCCCCFPCCRGSGKNNMGAWRDHDDSAFTEPRYH
VRREDLGKLHRAAWWGEVPRADLIVMLRGPGINKRDKKKRTALHLACANGNSEVVSLLLD
RQCQLHVFDSKKRTALIKAVQCQEDECALMLLQHGTDPNLPDMYGNTALHYAVYNEDKLM
AKTLLLYGADIESKNKGGLTPLLLAVHGQKQRMVKFLIKKKANLNALDRFGRICQLLSDY
KENQMPNNSSGNSNPEQDLKLTSEEEPQRLKGSENSQHEKVTQEPDINKDCDREVEEEMQ
KHGSNNVGLSENLTDGAAAGNGDGGLVPQRKSRKHENQQFPNTEIEEYHRPEKKSNEKNK
VKSQIHSVDNLDDITWPSEIASEDYDLLFSNYETFTLLIEQLKMDFNDSASLSKIQDAVI
SEEHLLELKNSHYEQLTVEVEQMENMVHVLQK
Download sequence
Identical sequences HR6137 NP_001002920.1.87134 NP_001002920.1.92137 gi|50897294|ref|NP_001002920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]