SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|5174729|ref|NP_006013.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|5174729|ref|NP_006013.1|
Domain Number 1 Region: 59-130
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 5.75e-31
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|5174729|ref|NP_006013.1|
Sequence length 144
Comment TSC22 domain family protein 1 isoform 2 [Homo sapiens]
Sequence
MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMD
LVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPP
ATTQPQGTTQPPAQPASQGSGPTA
Download sequence
Identical sequences A0A024RDV8 A0A1S2ZYP4 A0A1S3EL72 A0A250YA01 A0A287AII3 A0A287D576 A0A2I2UVA2 A0A2I2ZLV8 A0A2I3LLU7 A0A2J8VSQ0 A0A2K5C5I7 A0A2K5JQA8 A0A2K5KU36 A0A2K5QL49 A0A2K5YUP0 A0A2K6ALR7 A0A2K6F1V0 A0A2K6LAF2 A0A2K6SNR2 F6TA11 F7DWP7 H9YY78 J9P2M0 K7D9C4 K9IY98 L5ME08 Q3MHL6 Q4R4H5
ENSECAP00000012508 ENSBTAP00000025431 ENSCJAP00000036846 NP_001029549.1.59421 NP_001029549.1.76553 NP_001126969.1.23681 NP_006013.1.87134 NP_006013.1.92137 XP_003482942.1.46622 XP_003639849.1.84170 XP_003934416.1.74449 XP_003954302.1.37143 XP_004054496.1.27298 XP_004604643.1.94378 XP_005340416.1.77405 XP_005585828.1.63531 XP_005601306.1.31192 XP_005896194.1.15283 XP_006053464.1.26621 XP_006176318.1.101512 XP_006755382.1.95426 XP_007526674.1.11023 XP_007958506.1.81039 XP_008143777.1.99482 XP_008159852.1.99482 XP_008705046.1.72690 XP_008958061.1.60992 XP_008996464.1.60252 XP_010852916.1.44457 XP_010949681.1.22495 XP_010979161.1.51371 XP_011289612.1.62641 XP_011756593.1.29376 XP_011795550.1.43180 XP_011795555.1.43180 XP_011830004.1.47321 XP_011830005.1.47321 XP_011919764.1.92194 XP_012017570.1.54773 XP_012321232.1.9421 XP_012504382.1.63892 XP_012638197.1.48125 XP_012661055.1.62490 XP_012864699.1.60039 XP_012915270.1.14098 XP_014694354.1.49734 XP_014976492.1.72884 XP_015339803.1.40921 XP_016060918.1.3490 XP_017391499.1.71028 XP_017519318.1.32401 XP_017726482.1.44346 XP_017912262.1.57651 XP_019303048.1.44245 XP_020037154.1.5219 XP_020750887.1.74333 ENSSSCP00000010058 ENSSSCP00000010058 ENSBTAP00000025431 ENSCAFP00000039797 ENSP00000261489 9796.ENSECAP00000012508 ENSP00000261489 gi|5174729|ref|NP_006013.1| ENSECAP00000012508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]