SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52486251|ref|NP_001004426.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52486251|ref|NP_001004426.1|
Domain Number 1 Region: 141-394
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.23e-57
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 427-740
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.88e-41
Family Patatin 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|52486251|ref|NP_001004426.1|
Sequence length 752
Comment 85 kDa calcium-independent phospholipase A2 isoform b [Homo sapiens]
Sequence
MQFFGRLVNTFSGVTNLFSNPFRVKEVAVADYTSSDRVREEGQLILFQNTPNRTWDCVLV
NPRNSQSGFRLFQLELEADALVNFHQYSSQLLPFYESSPQVLHTEVLQHLTDLIRNHPSW
SVAHLAVELGIRECFHHSRIISCANCAENEEGCTPLHLACRKGDGEILVELVQYCHTQMD
VTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLL
LCNARCNIMGPNGYPIHSAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMA
RMLLKRGCNVNSTSSAGNTALHVAVMRNRFDCAIVLLTHGANADARGEHGNTPLHLAMSK
DNVEMIKALIVFGAEVDTPNDFGETPTFLASKIGRQLQDLMHISRARKPAFILGSMRDEK
RTHDHLLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSM
AYMRGMYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQPA
ELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTYFRPNGRFLDGG
LLANNPTLDAMTEIHEYNQDLIRKGQANKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNP
WELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVS
DTVLVNALWETEVYIYEHREEFQKLIQLLLSP
Download sequence
Identical sequences NP_001004426.1.87134 NP_001004426.1.92137 NP_001186491.1.87134 NP_001186491.1.92137 XP_016884470.1.92137 XP_016884471.1.92137 ENSP00000335149 ENSP00000386100 gi|313760592|ref|NP_001186491.1| gi|52486251|ref|NP_001004426.1| ENSP00000335149 ENSP00000386100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]