SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|52632385|ref|NP_001005335.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|52632385|ref|NP_001005335.1|
Domain Number 1 Region: 66-158
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.99e-18
Family Canonical RBD 0.00037
Further Details:      
 
Domain Number 2 Region: 192-321
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.76e-17
Family Canonical RBD 0.0055
Further Details:      
 
Domain Number 3 Region: 1-55
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000557
Family Canonical RBD 0.00079
Further Details:      
 
Domain Number 4 Region: 357-436
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000837
Family Canonical RBD 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|52632385|ref|NP_001005335.1|
Sequence length 456
Comment heterogeneous nuclear ribonucleoprotein L isoform b [Homo sapiens]
Sequence
MPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNS
VLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNG
ADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDH
PAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRYGPQYGHPPPPPPPP
EYGPHADSPVLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVD
RAITHLNNNFMFGQKLNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQAAK
NRIQHPSNVLHFFNAPLEVTEENFFEICDELGVKRPSSVKVFSGKSERSSSGLLEWESKS
DALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQHAS
Download sequence
Identical sequences A0A2J8QF72 A0A2K5JJG3 A0A2K5YDQ4 A0A2K6S0H6 F6V7W4
ENSP00000470231 ENSP00000470231 gi|52632385|ref|NP_001005335.1| NP_001005335.1.87134 NP_001005335.1.92137 XP_003812309.1.60992 XP_003943172.1.74449 XP_004396465.1.74151 XP_005218970.1.76553 XP_005589195.1.63531 XP_005589196.1.63531 XP_005890602.1.15283 XP_006739448.1.47382 XP_007114632.1.24612 XP_007114633.1.24612 XP_007114634.1.24612 XP_007114635.1.24612 XP_007464738.1.90284 XP_007464739.1.90284 XP_008962909.1.60992 XP_009433643.1.37143 XP_010379244.1.97406 XP_011525191.1.92137 XP_011763164.1.29376 XP_011763165.1.29376 XP_011763166.1.29376 XP_011807789.1.43180 XP_011828726.1.47321 XP_011933858.1.92194 XP_011986613.1.54773 XP_012416462.1.74151 XP_012512543.1.63892 XP_012630147.1.48125 XP_012630148.1.48125 XP_012630149.1.48125 XP_012903073.1.14098 XP_014332106.1.15283 XP_014956052.1.66739 XP_014979284.1.72884 XP_014979286.1.72884 XP_014979287.1.72884 XP_016789546.1.37143 XP_017362052.1.71028 XP_017362055.1.71028 XP_017917854.1.57651 XP_019287664.1.44245 XP_019675133.1.62641 XP_020726003.1.74333 ENSCJAP00000025666 ENSCJAP00000042166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]