SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|53692187|ref|NP_001005386.1| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53692187|ref|NP_001005386.1|
Domain Number 1 Region: 155-392
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.67e-74
Family Actin/HSP70 0.0000000271
Further Details:      
 
Domain Number 2 Region: 6-162
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 6.38e-51
Family Actin/HSP70 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|53692187|ref|NP_001005386.1|
Sequence length 399
Comment actin-related protein 2 isoform a [Homo sapiens]
Sequence
MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKNNKKMDL
MVGDEASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMN
PTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSL
PHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETVRMIKEKLCYVGYNIEQEQKLAL
ETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAELLFNTIQAADIDTRS
EFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVF
LGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR
Download sequence
Identical sequences A0A0D9RQK6 A0A1S3ASB3 A0A1U7TLZ5 A0A286X9F6 A0A287D8I7 A0A2I2UP96 A0A2I3GB21 A0A2I3MDQ4 A0A2I3TS83 A0A2J8XC25 A0A2K5F7Y3 A0A2K5MIW0 A0A2K5R9G9 A0A2K5VKV4 A0A2K5ZJW9 A0A2K6E490 A0A2K6GKS4 A0A2K6MBJ6 A0A2K6RKM0 A0A2K6TU47 F6QA36 G5C5Z4 I2CYF0 U3EIC6
ENSP00000367220 ENSP00000367220 HGL_H00000367220 9606.ENSP00000367220 NP_001005386.1.87134 NP_001005386.1.92137 XP_002709882.1.1745 XP_002757734.1.60252 XP_003262509.1.23891 XP_003363034.1.31192 XP_003467526.2.53824 XP_003830950.1.60992 XP_003984109.1.62641 XP_004397544.1.74151 XP_004435672.1.5094 XP_004471026.1.11602 XP_004710228.1.18182 XP_005385747.1.28644 XP_005575786.1.63531 XP_005662565.1.46622 XP_005963503.1.78601 XP_006053589.1.26621 XP_006083333.1.53796 XP_006168104.1.99106 XP_006201580.1.17985 XP_006514843.1.92730 XP_006778593.1.95426 XP_006881030.1.29581 XP_007075404.1.5354 XP_007189815.1.59432 XP_007464165.1.90284 XP_007539666.1.11023 XP_008061064.1.4292 XP_008145758.1.99482 XP_008584402.1.73410 XP_008850683.1.79516 XP_010331831.1.74449 XP_010354124.1.97406 XP_010962074.1.22495 XP_010978220.1.51371 XP_011711735.1.29376 XP_011840896.1.47321 XP_011895011.1.92194 XP_011981189.1.54773 XP_012332642.1.9421 XP_012620398.1.48125 XP_013208962.1.66349 XP_014692257.1.49734 XP_014949789.1.66739 XP_014967992.1.72884 XP_016015326.1.101085 XP_016804132.1.37143 XP_017377618.1.71028 XP_017507984.1.32401 XP_017745513.1.44346 XP_019293618.1.44245 XP_019491070.1.44202 XP_019573653.1.88060 XP_020017270.1.5219 XP_020141777.1.48125 XP_021066367.1.100879 XP_021482910.1.76796 XP_021579985.1.77405 XP_852707.1.84170 ENSPTRP00000020591 ENSPANP00000018751 ENSP00000367220 gi|53692187|ref|NP_001005386.1| ENSPTRP00000020591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]