SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|53828703|ref|NP_001005365.2| from Homo sapiens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|53828703|ref|NP_001005365.2|
Domain Number 1 Region: 56-287
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-60
Family Ankyrin repeat 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|53828703|ref|NP_001005365.2|
Sequence length 498
Comment POTE ankyrin domain family member A isoform 2 [Homo sapiens]
Sequence
MVAEVSPKLAASPMKKPFGFRGKMGKWCCCCFPCCRGSGKNNMGAWRDHDDSAFTEPRYH
VRREDLGKLHRAAWWGEVPRADLIVMLRGPGINKRDKKKRTALHLACANGNSEVVSLLLD
RQCQLHVFDSKKRTALIKAVQCQEDECALMLLQHGTDPNLPDMYGNTALHYAVYNEDKLM
AKTLLLYGADIESKNKGGLTPLLLAVHGQKQRMVKFLIKKKANLNALDRFGRTALILAVR
CGSASIVSLLLQQNIDVFSQDVFGQTAEDYAVSSHHSIICQLLSDYKENQMPNNSSGNSN
PEQDLKLTSEEEPQRLKGSENSQHEKVTQEPDINKDCDREVEEEMQKHGSNNVGLSENLT
DGAAAGNGDGGLVPQRKSRKHENQQFPNTEIEEYHRPEKKSNEKNKVKSQIHSVDNLDDI
TWPSEIASEDYDLLFSNYETFTLLIEQLKMDFNDSASLSKIQDAVISEEHLLELKNSHYE
QLTVEVEQMENMVHVLQK
Download sequence
Identical sequences Q6S8J7
HR6146 gi|53828703|ref|NP_001005365.2| 9606.ENSP00000346193 NP_001005365.2.87134 NP_001005365.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]